Recombinant Avian infectious bronchitis virus Non-structural protein 3b (3b)

In Stock
Code CSB-EP361472ARW
Abbreviation Recombinant Avian infectious bronchitis virus Non-structural protein 3b
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
3b
Uniprot No.
Research Area
others
Alternative Names
ns3b;Accessory protein 3b
Species
Avian infectious bronchitis virus (strain M41) (IBV)
Source
E.coli
Expression Region
1-64aa
Target Protein Sequence
MLNLEAIIETGEQVIQKISFNLQHISSVLNTEVFDPFDYCYYRGGNFWEIESAEDCSGDDEFIE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
8.4 kDa
Protein Length
Full Length
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

This recombinant avian infectious bronchitis virus Non-structural protein 3b (3b) gets expressed in E. coli and contains the complete sequence spanning amino acids 1-64. The protein carries a C-terminal 6xHis-tag, which makes purification and detection more straightforward. SDS-PAGE analysis shows purity levels exceeding 85%, suggesting it should work reliably in research settings. This product is meant strictly for research purposes and cannot be used in therapeutic or diagnostic procedures.

Non-structural protein 3b (3b) from avian infectious bronchitis virus appears to play an important role in how the virus completes its lifecycle and replicates. Since it's involved in viral pathogenesis, researchers study this protein to better understand viral mechanisms and how viruses interact with their hosts. Work on protein 3b may help build a clearer picture of viral replication strategies and could inform efforts to develop interventions against avian infectious bronchitis.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, the recombinant IBV non-structural protein 3b is produced in an E. coli expression system, has a purity of >85% by SDS-PAGE, and includes a C-terminal 6xHis tag. However, there is a high probability that this protein is not correctly folded or bioactive. The E. coli system lacks the eukaryotic machinery for post-translational modifications and chaperones, which are often critical for viral proteins to achieve native conformation. While non-structural proteins like 3b may have simpler folding requirements, the absence of validation data (e.g., circular dichroism for secondary structure or functional assays) means folding cannot be assumed. Thus, without experimental proof, the protein is likely misfolded and inactive for applications requiring native structure.

1. Antibody Development and Characterization

This protein is suitable as an immunogen for generating antibodies targeting linear epitopes, as antibody development often relies on amino acid sequences rather than native folding. The 85%
+ purity is acceptable, but contaminants might induce non-specific antibodies. However, if antibodies are intended to recognize conformational epitopes of the native 3b protein (e.g., in immunofluorescence or neutralization assays), misfolding could render them ineffective. The His-tag simplifies purification but may also elicit tag-specific antibodies.

2. Structural and Biophysical Analysis

The protein is unsuitable for structural studies without confirmation of correct folding. Techniques like circular dichroism or dynamic light scattering could be applied, but data from a misfolded protein would not reflect the native structure of 3b. The E. coli expression system increases the risk of aggregation or non-native conformations, making results unreliable for understanding biological function.

3. ELISA-Based Detection Assay Development

This recombinant protein could be used in ELISA for detecting antibodies against linear epitopes, as the His-tag facilitates immobilization. However, if the assay aims to detect antibodies that recognize conformational epitopes (e.g., for serotyping or neutralization studies), misfolding would reduce sensitivity and specificity. Consistency might be affected by batch-to-batch folding variations.

Final Recommendation & Action Plan

To ensure reliable outcomes, prioritize experimental validation of protein folding and bioactivity before any application. Start with biophysical techniques (e.g., circular dichroism to assess secondary structure and size-exclusion chromatography to evaluate oligomeric state) to confirm folding. If resources allow, develop a functional assay—though challenging for non-structural proteins like 3b, interaction studies with known partners (e.g., other viral proteins from infected cells) could serve as a proxy. If validation fails, restrict use to linear-epitope antibody production or as a negative control in folding studies, clearly disclosing limitations in research communications.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*