Recombinant Avian infectious bronchitis virus Non-structural protein 3b (3b)

In Stock
Code CSB-YP339083ARN
Abbreviation Recombinant Avian infectious bronchitis virus Non-structural protein 3b
MSDS
Size $436
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
3b
Uniprot No.
Research Area
Microbiology
Alternative Names
ns3b;Accessory protein 3b
Species
Avian infectious bronchitis virus (strain Beaudette) (IBV)
Source
Yeast
Expression Region
1-64aa
Target Protein Sequence
MLNLEVIIETGEQVIQKISFNLQHISSVLNTEVFDPFDYCYYRGGNFWEIESAEDCSGDDEFIE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
8.9 kDa
Protein Length
Full Length
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Avian infectious bronchitis virus Non-structural protein 3b (3b) is produced in yeast, covering the full-length expression region from 1 to 64 amino acids. The protein carries a C-terminal 6xHis-tag, which helps with purification and detection. SDS-PAGE analysis shows it achieves a purity level exceeding 90%, which should ensure high-quality results for research applications. This product is intended strictly for research use and not for clinical applications.

Non-structural protein 3b from the Avian infectious bronchitis virus appears to play a role in the virus's replication and assembly processes. As part of the viral machinery, it may be crucial for understanding the lifecycle and pathogenicity of IBV. Research on this protein could provide insights into viral replication mechanisms, potentially offering valuable information for virology research and therapeutic interventions.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Antibody Development and Characterization

This recombinant IBV non-structural protein 3b can work as an immunogen for generating polyclonal or monoclonal antibodies specific to this viral protein. The C-terminal 6xHis tag makes purification and immobilization easier for antibody screening assays. Researchers might use this protein in ELISA-based assays to characterize antibody specificity, affinity, and cross-reactivity. The high purity (>90%) should minimize contamination that could interfere with antibody development protocols.

2. Protein-Protein Interaction Studies

The 6xHis-tagged protein works well in pull-down assays to identify potential cellular or viral protein partners that interact with IBV non-structural protein 3b. The tag allows efficient immobilization on nickel-affinity matrices for capturing interacting proteins from cell lysates or viral protein preparations. This approach may help reveal the functional networks involving this non-structural protein during viral replication or host cell interaction studies.

3. Biochemical Characterization and Structural Studies

This purified recombinant protein provides material for basic biochemical analyses including molecular weight confirmation, protein stability studies, and preliminary structural characterization. Researchers can perform techniques such as dynamic light scattering, circular dichroism spectroscopy, or analytical ultracentrifugation to understand the protein's biophysical properties. The yeast expression system might provide proper protein folding for meaningful structural investigations, though results can vary.

4. Viral Protein Detection Assay Development

The recombinant protein works as a positive control and standard in research assays designed to detect IBV non-structural protein 3b in experimental samples. The defined concentration and high purity make it suitable for establishing detection limits and validating assay performance in research applications. This standardized protein preparation enables consistent results across different laboratory experiments studying IBV infection or replication.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*