Home
Protein
Recombinant Protein
Recombinant Escherichia phage T7 Single-stranded DNA-binding protein (2.5)

Recombinant Escherichia phage T7 Single-stranded DNA-binding protein (2.5)

^{In Stock}

Code	CSB-EP366021EEB
MSDS	MSDS
Size	US$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

2.5

Uniprot No.

P03696

Alternative Names

2.5Single-stranded DNA-binding protein gp2.5; SSB protein

Species

Enterobacteria phage T7 (Bacteriophage T7)

Source

E.coli

Expression Region

1-232aa

Target Protein Sequence

MAKKIFTSALGTAEPYAYIAKPDYGNEERGFGNPRGVYKVDLTIPNKDPRCQRMVDEIVKCHEEAYAAAVEEYEANPPAVARGKKPLKPYEGDMPFFDNGDGTTTFKFKCYASFQDKKTKETKHINLVVVDSKGKKMEDVPIIGGGSKLKVKYSLVPYKWNTAVGASVKLQLESVMLVELATFGGGEDDWADEVEENGYVASGSAKASKPRDEESWDEDDEESEEADEDGDF
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

41.9kDa

Protein Length

Full Length

Tag Info

N-terminal 6xHis-SUMO-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Tris-based buffer,50% glycerol

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Constructing a plasmid encoding the Enterobacteria phage T3 (Bacteriophage T3) SSB protein protein (1-232aa) is the initial step in the general approach to express the recombinant Enterobacteria phage T3 (Bacteriophage T3) SSB protein protein. The plasmid is then transformed into e.coli cells. Positive e.coli cells are selected and cultured, protein expression is induced, and cells are lysed. The protein is fused with a N-terminal 6xHis-SUMO tag. The resulting recombinant Enterobacteria phage T3 (Bacteriophage T3) SSB protein protein is then purified through affinity purification, and SDS-PAGE analysis is carried out to verify the presence and assess the purity of the protein. Its purity exceeds 90%.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

■ Q&A

1. I am wondering if any sort of DNA binding activity has been verified prior to shipping?
2. What is the purification protocol for these proteins?
3. Does the recombinant SSB expressed in E. coli still retain the His-Sumo tag? Or is it cleaved?

Thanks for your inquiry. Please kindly check the product details, code, name, tag type, especially expression sequence, and confirm which protein you actually want.
We have also provided Uniprot link for you reference, so you will be more clear about the difference between the two products and make your decision.
1. Code: CSB-EP366021EEB
Name: Recombinant Enterobacteria phage T7 Single-stranded DNA-binding protein gp2.5 (2.5)
Expression Region: 1-232aa, Full Length
Tag Info: N-terminal 6xHis-SUMO-tag
Expression Sequence:

Uniprot Link: http://www.uniprot.org/uniprot/P03696
2. Code: CSB-EP321793EDY
Name: Recombinant Enterobacteria phage T3 Helix-destabilizing protein (2.5)
Expression Region: 1-232aa, Full Length
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Expression Sequence:

MAGFKKKVYTSGLGTAEPYAYLSKPDYGNEERGFGNPRGVYKVDLTLSNKDPRCQAMVDEIVKTHEEAYAAAVEEFEANPPQVQRGKKPLTPYEGDMPFFDNGDGTTTFKFKCYASFQDKKTKETKHINLVVVDSKGKKIQEVPIIGGGSKLKVKYSLVPYKWNTAVGASVKLQLESVMLVELATFGGGGEDEWADEVEDGGYTASESRQSRDEQEWQEDEHEETPDDDEDF

Uniprot Link: http://www.uniprot.org/uniprot/P20313
Note: CSB-EP321793EDY is a semi-customized protein instead of developed protein, so the price will be relatively higher and the smallest size will be 50ug.
Shipping format: The default delivery form is liquid form. If you have demand for lyophilized form, please remark this requirement when placing order.
Optional service: Do you want aseptic processing and/or endotoxin removal for this protein (recommended for cell culture or in vivo use)?
With our endotoxin removal service we guarantee the endotoxin level to be less than 0.1ng/ug (1EU ug).
Both aseptic processing and endotoxin removal services are free of charge, however they must be requested when the order is placed.
Shipping condition: These products are routinely shipped on ice packs.
Free Service: Endotoxin removal, Filter-sterilization, Lyophilization (Note: Lyophilization and filter-sterilization can’t be met at the same time)

Target Background

Function

Single-stranded DNA-binding protein that participates in viral DNA replication, formation of concatemers, recombination and repair of double-stranded breaks. Coats the lagging-strand ssDNA as the replication fork advances and stimulates the activities of viral DNA polymerase and primase/helicase. Coordinates simultaneous synthesis of leading- and lagging-strands. Together with DNA primase/helicase, promotes pairing of two homologous DNA molecules containing complementary single-stranded regions and mediates homologous DNA strand exchange. Promotes also the formation of joint molecules. Disrupts loops, hairpins and other secondary structures present on ssDNA to reduce and eliminate pausing of viral DNA polymerase at specific sites during elongation.

Gene References into Functions

analysis of the interaction of the single-stranded DNA-binding protein of bacteriophage T7 with the DNA polymerase-thioredoxin complex PMID: 20375019
results support a model in which dimerization interactions must be broken for DNA binding, and gp2.5 monomers search dsDNA by 1D diffusion to bind ssDNA. PMID: 18772224

Database Links

KEGG: vg:1261080

Promotions