Recombinant Escherichia coli O157:H7 Translocated intimin receptor Tir (tir), partial

In Stock
Code CSB-EP514896EOF
Abbreviation Recombinant E.coli O157:H7 tir protein, partial
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
tir
Uniprot No.
Research Area
Others
Alternative Names
tir; espE; ECSP_4676; Translocated intimin receptor Tir; Secreted effector protein Tir
Species
Escherichia coli O157:H7 (strain TW14359 / EHEC)
Source
E.coli
Expression Region
252-362aa
Target Protein Sequence
QALALTPEPDSPTTTDPDAAASATETATRDQLTKEAFQNPDNQKVNIDELGNAIPSGVLKDDVVANIEEQAKAAGEEAKQQAIENNAQAQKKYDEQQAKRQEELKVSSGAG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
27.8kDa
Protein Length
Extracellular Domain
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Escherichia coli O157:H7 Translocated intimin receptor Tir is expressed in E. coli, covering the extracellular domain region of 252-362 amino acids. The protein carries an N-terminal 6xHis-SUMO tag to help with purification and reaches purity levels above 90%, as confirmed through SDS-PAGE analysis. This product is made specifically for research purposes and is not intended for clinical applications.

The Translocated intimin receptor (Tir) appears to be a critical component in how Escherichia coli O157:H7 causes disease, particularly in its interactions with host cells. When Tir gets translocated into host cells, it seems to integrate into the host membrane, where it likely functions as a receptor for the bacterial adhesin intimin. This interaction may be essential for forming attaching and effacing lesions, which makes Tir an important target for researchers studying bacterial pathogenesis and how pathogens interact with their hosts.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Escherichia coli O157:H7 Translocated intimin receptor Tir is a bacterial virulence factor that requires precise folding, proper membrane association, and specific tertiary structure for its functional activity in host cell adhesion. The extracellular domain fragment (252-362aa) lacks the transmembrane and intracellular domains essential for full Tir functionality and proper structural context. The E. coli expression system is homologous to this bacterial protein, which increases the probability of correct folding. However, the large N-terminal 6xHis-SUMO tag (∼15 kDa) may sterically interfere with the protein's functional domains and intimin-binding interfaces. While the homologous expression system favors proper folding, the extracellular fragment nature and tag interference necessitate experimental validation of structural integrity and binding capability.

1. Antibody Development and Characterization Studies

This application is highly suitable as antibody development relies on antigenic sequence recognition rather than functional protein conformation. The extracellular domain provides specific epitopes for generating antibodies against the Tir intimin-binding region. The high purity (>90%) ensures minimal contamination-related issues during immunization protocols.

2. Protein-Protein Interaction Studies

This application carries a significant risk without proper folding validation. Tir's interaction with intimin requires the precise tertiary structure of the extracellular domain. If correctly folded (verified through intimin binding assays), the protein may identify physiological binding partners. If misfolded/unverified, there is a high risk of non-specific binding or failure to replicate genuine host-pathogen interactions. The SUMO tag may sterically block the intimin-binding site.

3. Structural and Biochemical Characterization

These studies are essential for determining folding status. Techniques should include circular dichroism spectroscopy to assess secondary structure, size-exclusion chromatography to evaluate oligomeric state, and thermal shift assays to determine stability. However, the SUMO tag may interfere with crystallization for high-resolution structural studies.

4. In Vitro Binding and Competition Assays

This application requires rigorous functional validation. Tir-intimin binding requires native conformation of the extracellular domain. If correctly folded and active (verified), limited binding studies may be possible. If misfolded/inactive (unverified), competition assays will yield biologically misleading results. The SUMO tag may physically prevent proper intimin access to the binding interface.

Final Recommendation & Action Plan

The homologous E. coli expression system provides favorable conditions for this bacterial virulence factor, but the extracellular domain fragment and large SUMO tag necessitate experimental validation before functional applications. Begin with Application 3 (Structural Characterization) to assess folding quality through CD spectroscopy, SEC, and validate intimin-binding capability using known interaction partners. Applications 2 and 4 require rigorous functional validation before proceeding. Application 1 (antibody development) can proceed immediately. Consider SUMO tag removal for critical binding studies to minimize steric interference. Always include appropriate controls and validate key findings with full-length Tir when possible for reliable host-pathogen interaction research.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Multifunctional protein that is required for efficient pedestal formation in host epithelial cells during infection. The extracellular region acts as a receptor for bacterial intimin, allowing the bacterium to attach tightly to the host-cell surface. Simultaneously, the intracellular region initiates a signaling cascade in the host cell, which leads to actin polymerization and formation of actin pedestals at the sites of bacterial adhesion.
Subcellular Location
Secreted. Host cell membrane; Multi-pass membrane protein.
Protein Families
Tir receptor family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*