Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
| Code | CSB-RP105994h |
| Size | $1812 How to order? |
| Image |
|
| Have Questions? | Leave a Message or Start an on-line Chat |
| Description |
Recombinant Human Complement C3 (C3) is a partial-length protein expressed with N-terminal 6xHis-tagged in the E.coli. Its expression region corresponds to 26-225aa of human C3 protein. Its purity was determined by SDS-PAGE and reached up to 90% and presented a molecular mass band of 26.4kDa on the gel. This recombinant C3 protein may be used to synthesize antibodies against C3. C3 proteins in-stock are available.
Complement C3(C3) plays a central role in the activation of complement system. Its activation by C3 convertase is required for both classical and alternative complement activation pathways. C3 mutations are associated with atypical hemolytic uremic syndrome and age-related macular degeneration in human patients. Diseases associated with C3 include Complement Component 3 Deficiency, Autosomal Recessive and Hemolytic Uremic Syndrome, Atypical 5. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Target Names | C3 |
| Uniprot No. | P01024 |
| Research Area | Immunology |
| Alternative Names | ASP; C3 and PZP-like alpha-2-macroglobulin domain-containing protein 1; C3; C3adesArg; C3bc; CO3_HUMAN; Complement C3c alpha'' chain fragment 2 |
| Species | Homo sapiens (Human) |
| Source | E.coli |
| Expression Region | 26-225aa |
| Target Protein Sequence | YSIITPNILRLESEETMVLEAHDAQGDVPVTVTVHDFPGKKLVLSSEKTVLTPATNHMGNVTFTIPANREFKSEKGRNKFVTVQATFGTQVVEKVVLVSLQSGYLFIQTDKTIYTPGSTVLYRIFTVNHKLLPVGRTVMVNIENPEGIPVKQDSLSSQNQLGVLPLSWDIPELVNMGQWKIRAYYENSPQQVFSTEFEVK Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
| Mol. Weight | 26.4kDa |
| Protein Length | Partial |
| Tag Info |
N-terminal 6xHis-tagged |
| Form |
Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
| Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Troubleshooting and FAQs |
Protein FAQs |
| Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Lead Time | 3-7 business days |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
| Function |
C3 plays a central role in the activation of the complement system. Its processing by C3 convertase is the central reaction in both classical and alternative complement pathways. After activation C3b can bind covalently, via its reactive thioester, to cell surface carbohydrates or immune aggregates.; Derived from proteolytic degradation of complement C3, C3a anaphylatoxin is a mediator of local inflammatory process. In chronic inflammation, acts as a chemoattractant for neutrophils. It induces the contraction of smooth muscle, increases vascular permeability and causes histamine release from mast cells and basophilic leukocytes.; Acts as a chemoattractant for neutrophils in chronic inflammation.; adipogenic hormone that stimulates triglyceride (TG) synthesis and glucose transport in adipocytes, regulating fat storage and playing a role in postprandial TG clearance. Appears to stimulate TG synthesis via activation of the PLC, MAPK and AKT signaling pathways. Ligand for C5AR2. Promotes the phosphorylation, ARRB2-mediated internalization and recycling of C5AR2.
|
| Gene References into Functions |
|
| Involvement in disease | Complement component 3 deficiency (C3D); Macular degeneration, age-related, 9 (ARMD9); Hemolytic uremic syndrome atypical 5 (AHUS5) |
| Subcellular Location | Secreted. |
| Tissue Specificity | Plasma. The acylation stimulating protein (ASP) is expressed in adipocytes and released into the plasma during both the fasting and postprandial periods. |
| Database Links |
HGNC: 1318 OMIM: 120700 KEGG: hsa:718 STRING: 9606.ENSP00000245907 UniGene: Hs.529053 |
