Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
ASP; C3 and PZP-like alpha-2-macroglobulin domain-containing protein 1; C3; C3adesArg; C3bc; CO3_HUMAN; Complement C3c alpha'' chain fragment 2
Species
Homo sapiens (Human)
Expression Region
26-225aa
Target Protein Sequence
YSIITPNILRLESEETMVLEAHDAQGDVPVTVTVHDFPGKKLVLSSEKTVLTPATNHMGNVTFTIPANREFKSEKGRNKFVTVQATFGTQVVEKVVLVSLQSGYLFIQTDKTIYTPGSTVLYRIFTVNHKLLPVGRTVMVNIENPEGIPVKQDSLSSQNQLGVLPLSWDIPELVNMGQWKIRAYYENSPQQVFSTEFEVK
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Recombinant Human Complement C3 (C3) is a partial-length protein expressed with N-terminal 6xHis-tagged in the E.coli. Its expression region corresponds to 26-225aa of human C3 protein. Its purity was determined by SDS-PAGE and reached up to 90% and presented a molecular mass band of 26.4kDa on the gel. This recombinant C3 protein may be used to synthesize antibodies against C3. C3 proteins in-stock are available.
Complement C3(C3) plays a central role in the activation of complement system. Its activation by C3 convertase is required for both classical and alternative complement activation pathways. C3 mutations are associated with atypical hemolytic uremic syndrome and age-related macular degeneration in human patients. Diseases associated with C3 include Complement Component 3 Deficiency, Autosomal Recessive and Hemolytic Uremic Syndrome, Atypical 5.