Recombinant Rat Artemin (Artn)

In Stock
Code CSB-EP002160RA
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP002160RA could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) Artn.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP002160RA could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) Artn.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Artn
Uniprot No.
Alternative Names
ArtnArtemin
Species
Rattus norvegicus (Rat)
Source
E.coli
Expression Region
112-224aa
Target Protein Sequence
AGTRSSRARATDARGCRLRSQLVPVSALGLGHSSDELIRFRFCSGSCRRARSPHDLSLASLLDAGALRSPPGSRPISQPCCRPTRYEAVSFMDVNSTWRTVDHLSATACGCLG
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
17.1 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Our Recombinant Rat Artemin is a very helpful research tool for researcher in the area of Neuroscience. Originating from the 'Artn' gene of the Rat species, Artemin is a neurotrophic factor in the glial cell line-derived neurotrophic factor family, which plays a vital role in the development and function of the nervous system. The recombinant protein is sourced from E.coli, covering the full length of the mature protein, precisely from the 112th to the 224th amino acid.

The Recombinant Rat Artemin features N-terminal 10xHis-tagged and C-terminal Myc-tagged extensions, simplifying purification and detection processes. A purity of greater than 85%, as verified by SDS-PAGE, stands testament to our commitment to providing high-quality research products. Accommodating diverse research settings, our Artemin protein is offered in two forms - liquid or lyophilized powder, presenting versatility for your unique experimental setup.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Ligand for the GFR-alpha-3-RET receptor complex but can also activate the GFR-alpha-1-RET receptor complex. Supports the survival of sensory and sympathetic peripheral neurons in culture and also supports the survival of dopaminergic neurons of the ventral mid-brain. Strong attractant of gut hematopoietic cells thus promoting the formation Peyer's patch-like structures, a major component of the gut-associated lymphoid tissue.
Gene References into Functions
  1. Results indicate a previously unknown role of artemin in regulating inducible form of nitric oxide synthase (iNOS) expression in primary cultured TGNs, and regulation of iNOS might be involved in the mechanism through which artemin participates in the trigeminal pain pathway. PMID: 28899786
  2. artemin has a role in robust regeneration of large, myelinated sensory axons to the brainstem and in promoting functional reinnervation of the cuneate nucleus PMID: 25918373
  3. This study suggest that Artn regulates the expression and composition of nAChRs in GFRalpha3 nociceptors and that these changes contribute to the thermal hypersensitivity that develops in response to Artn injection and perhaps to inflammation. PMID: 24886596
  4. These anatomical results support the hypothesis that artemin contributes to dural afferent activity, and possibly migraine pain, through modulation of both primary afferent and sympathetic systems. PMID: 19845789
  5. ARTN acts as potent neurotrophic factor that may play an important role in the structural development and plasticity of ventral mesencephalic dopaminergic neurons PMID: 16325003
  6. Inhibition of DNA methylation suppressed the artemin-dependent neurite growth, which could be relevant to neurite elongation in mature dorsal root ganglia. PMID: 16781061
  7. These data indicate that artemin is expressed in arteries, and its receptors are expressed and functional in the postganglionic sympathetic neurons that innervate them. PMID: 17337595
  8. Artemin promoted re-entry of multiple classes of sensory fibers into the spinal cord and re-establishment of synaptic function and simple behavior as well as promoted the recovery of complex behavior. PMID: 18344995

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
TGF-beta family, GDNF subfamily
Tissue Specificity
Cochlea. Expressed at higher level in sesorineural epithelium than in the modiolus region or substantia nigra.
Database Links
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*