Recombinant Rat Artemin (Artn)

^{In Stock}

Code	CSB-EP002160RA
Abbreviation	Recombinant Rat Artn protein
MSDS	MSDS Datasheet
Size	$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP002160RA could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) Artn. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP002160RA could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) Artn.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

Artn

Uniprot No.

Q6AYE8

Alternative Names

ArtnArtemin

Species

Rattus norvegicus (Rat)

Source

E.coli

Expression Region

112-224aa

Target Protein Sequence

AGTRSSRARATDARGCRLRSQLVPVSALGLGHSSDELIRFRFCSGSCRRARSPHDLSLASLLDAGALRSPPGSRPISQPCCRPTRYEAVSFMDVNSTWRTVDHLSATACGCLG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

17.1 kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Our Recombinant Rat Artemin is a very helpful research tool for researcher in the area of Neuroscience. Originating from the 'Artn' gene of the Rat species, Artemin is a neurotrophic factor in the glial cell line-derived neurotrophic factor family, which plays a vital role in the development and function of the nervous system. The recombinant protein is sourced from E.coli, covering the full length of the mature protein, precisely from the 112th to the 224th amino acid.

The Recombinant Rat Artemin features N-terminal 10xHis-tagged and C-terminal Myc-tagged extensions, simplifying purification and detection processes. A purity of greater than 85%, as verified by SDS-PAGE, stands testament to our commitment to providing high-quality research products. Accommodating diverse research settings, our Artemin protein is offered in two forms - liquid or lyophilized powder, presenting versatility for your unique experimental setup.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function

Ligand for the GFR-alpha-3-RET receptor complex but can also activate the GFR-alpha-1-RET receptor complex. Supports the survival of sensory and sympathetic peripheral neurons in culture and also supports the survival of dopaminergic neurons of the ventral mid-brain. Strong attractant of gut hematopoietic cells thus promoting the formation Peyer's patch-like structures, a major component of the gut-associated lymphoid tissue.

Gene References into Functions

Results indicate a previously unknown role of artemin in regulating inducible form of nitric oxide synthase (iNOS) expression in primary cultured TGNs, and regulation of iNOS might be involved in the mechanism through which artemin participates in the trigeminal pain pathway. PMID: 28899786
artemin has a role in robust regeneration of large, myelinated sensory axons to the brainstem and in promoting functional reinnervation of the cuneate nucleus PMID: 25918373
This study suggest that Artn regulates the expression and composition of nAChRs in GFRalpha3 nociceptors and that these changes contribute to the thermal hypersensitivity that develops in response to Artn injection and perhaps to inflammation. PMID: 24886596
These anatomical results support the hypothesis that artemin contributes to dural afferent activity, and possibly migraine pain, through modulation of both primary afferent and sympathetic systems. PMID: 19845789
ARTN acts as potent neurotrophic factor that may play an important role in the structural development and plasticity of ventral mesencephalic dopaminergic neurons PMID: 16325003
Inhibition of DNA methylation suppressed the artemin-dependent neurite growth, which could be relevant to neurite elongation in mature dorsal root ganglia. PMID: 16781061
These data indicate that artemin is expressed in arteries, and its receptors are expressed and functional in the postganglionic sympathetic neurons that innervate them. PMID: 17337595
Artemin promoted re-entry of multiple classes of sensory fibers into the spinal cord and re-establishment of synaptic function and simple behavior as well as promoted the recovery of complex behavior. PMID: 18344995