Recombinant Human Tissue factor (F3), partial (Active)

In Stock Promotion
Code CSB-MP007928HU2
Abbreviation Recombinant Human F3 protein, partial (Active)
MSDS
Size $9.9
Promotion
CUSABIO Blowout: 4,100+ In-Stock Proteins
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Human TF at 2 μg/ml can bind Anti-TF recombinant antibody (CSB-RA007928MA2HU). The EC50 is 1.434-1.635 ng/mL. Biological Activity Assay
  • The purity of F3 was greater than 95% as determined by SEC-HPLC
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Greater than 95% as determined by SEC-HPLC.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human TF at 2 μg/mL can bind Anti-TF recombinant antibody (CSB-RA007928MA2HU). The EC50 is 1.434-1.635 ng/mL.
Target Names
Uniprot No.
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
33-251aa
Target Protein Sequence
SGTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECMGQEKGEFRE
Mol. Weight
26.2 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The generation for the recombinant human tissue factor (F3) involves gene amplification, plasmid creation, protein expression, purification, and characterization. Specific primers amplify the tissue factor region corresponding to amino acids 33-251, which is inserted into a plasmid containing a C-terminal 10xHis-tag. Mammalian cells are transfected with the plasmid, and after 24 hours, a selective antibiotic is used to identify the target protein-producing cells. The selected cells are cultured and induced to express the target proteins. The recombinant human tissue factor is released through cell lysis and purified from the supernatant using Ni-NTA affinity chromatography. The purified tissue factor protein achieves >95% purity (SDS-PAGE and SEC-HPLC) and <1.0 EU/μg endotoxin levels (LAL). ELISA confirms the functional binding of this recombinant tissue factor to the TF recombinant antibody (CSB-RA007928MA2HU) with an EC50 of 1.434-1.635 ng/mL.

Human tissue factor (TF), also known as thromboplastin, is a critical transmembrane glycoprotein that plays a pivotal role in the initiation of the extrinsic pathway of blood coagulation. It is primarily expressed in cells that are not typically in contact with blood, such as fibroblasts and endothelial cells, but can be induced by inflammatory cytokines, particularly in pathological conditions [1][4][10]. Upon vascular injury, TF binds to circulating factor VIIa (FVIIa), forming a complex that activates FIX and FX, leading to thrombin generation and subsequent clot formation [1][4][12]. TF also has significant roles beyond coagulation, influencing various pathophysiological processes including inflammation, angiogenesis, and tumor progression [2][9][12].

The signaling pathways activated by the TF-FVIIa complex are mediated through protease-activated receptors (PARs), specifically PAR1 and PAR2. These receptors are G-protein-coupled receptors that, when activated, can trigger a cascade of intracellular signaling events that contribute to cellular responses such as proliferation, migration, and survival [2][8]. The interaction of TF with FVIIa not only initiates coagulation but also modulates cellular behavior in non-hemostatic contexts, such as in cancer metastasis and inflammation [2][9][12]. The TF-FVIIa complex has been shown to enhance endothelial cell permeability and promote angiogenesis, which is crucial for tumor growth and metastasis [11][12].

Moreover, the regulation of TF activity is tightly controlled by tissue factor pathway inhibitor (TFPI), which serves as a natural anticoagulant. TFPI inhibits the TF-FVIIa complex and factor Xa, thereby preventing excessive coagulation and maintaining hemostatic balance [5][6][7]. The expression of TFPI can be modulated by various factors, including inflammatory cytokines, which can influence the overall coagulation response and the balance between pro-coagulant and anti-coagulant activities in the body [3][7]. Understanding the role of TF in coagulation and signaling pathways is crucial for developing therapeutic strategies for conditions such as thrombosis, cancer, and inflammatory diseases.

References:
[1] Adams, M., Thom, J., Hankey, G., Baker, R., Gilmore, G., Staton, J., … & Eikelboom, J. (2006). The tissue factor pathway in ischemic stroke. Blood Coagulation & Fibrinolysis, 17(7), 527-532. https://doi.org/10.1097/01.mbc.0000245294.41774.06
[2] Ahamed, J. and Ruf, W. (2004). Protease-activated receptor 2-dependent phosphorylation of the tissue factor cytoplasmic domain. Journal of Biological Chemistry, 279(22), 23038-23044. https://doi.org/10.1074/jbc.m401376200
[3] Ahamed, J., Belting, M., & Ruf, W. (2005). Regulation of tissue factor–induced signaling by endogenous and recombinant tissue factor pathway inhibitor 1. Blood, 105(6), 2384-2391. https://doi.org/10.1182/blood-2004-09-3422
[4] Camerer, E., Huang, W., & Coughlin, S. (2000). Tissue factor- and factor x-dependent activation of protease-activated receptor 2 by factor viia. Proceedings of the National Academy of Sciences, 97(10), 5255-5260. https://doi.org/10.1073/pnas.97.10.5255
[5] Girard, T., Grunz, K., Lasky, N., Malone, J., & Broze, G. (2018). Re‐evaluation of mouse tissue factor pathway inhibitor and comparison of mouse and human tissue factor pathway inhibitor physiology. Journal of Thrombosis and Haemostasis, 16(11), 2246-2257. https://doi.org/10.1111/jth.14288
[6] Lizakowski, S., Zdrojewski, Z., Jagodziński, P., & Rutkowski, B. (2007). Plasma tissue factor and tissue factor pathway inhibitor in patients with primary glomerulonephritis. Scandinavian Journal of Urology and Nephrology, 41(3), 237-242. https://doi.org/10.1080/00365590601016511
[7] Mast, A. (2016). Tissue factor pathway inhibitor. Arteriosclerosis Thrombosis and Vascular Biology, 36(1), 9-14. https://doi.org/10.1161/atvbaha.115.305996
[8] Rao, L. and Pendurthi, U. (2005). Tissue factor–factor viia signaling. Arteriosclerosis Thrombosis and Vascular Biology, 25(1), 47-56. https://doi.org/10.1161/01.atv.0000151624.45775.13
[9] Riewald, M. and Ruf, W. (2001). Mechanistic coupling of protease signaling and initiation of coagulation by tissue factor. Proceedings of the National Academy of Sciences, 98(14), 7742-7747. https://doi.org/10.1073/pnas.141126698
[10] Sethi, A., Lees, D., Douthwaite, J., & Corder, R. (2005). Factor viia stimulates endothelin-1 synthesis in tnf-primed endothelial cells by activation of protease-activated receptor 2. Clinical Science, 108(3), 255-263. https://doi.org/10.1042/cs20040237
[11] Uusitalo‐Järvinen, H., Kurokawa, T., Mueller, B., Andrade‐Gordon, P., Friedlander, M., & Ruf, W. (2007). Role of protease activated receptor 1 and 2 signaling in hypoxia-induced angiogenesis. Arteriosclerosis Thrombosis and Vascular Biology, 27(6), 1456-1462. https://doi.org/10.1161/atvbaha.107.142539
[12] Versteeg, H. and Ruf, W. (2006). Emerging insights in tissue factor-dependent signaling events. Seminars in Thrombosis and Hemostasis, 32(01), 024-032. https://doi.org/10.1055/s-2006-933337

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Initiates blood coagulation by forming a complex with circulating factor VII or VIIa. The [TF:VIIa] complex activates factors IX or X by specific limited proteolysis. TF plays a role in normal hemostasis by initiating the cell-surface assembly and propagation of the coagulation protease cascade.
Gene References into Functions
  1. TF knockout in MDA-MB-231cells reduced TF/FVIIa signaling and coagulation activity. Silencing of TF in MDA-MB-231cells decreased the release of microvesicles. PMID: 29787758
  2. Subjects with AG and GG genotype had significantly higher TF levels than AA genotype. GG genotype of 603A>G polymorphism augments the risk of thrombosis by 4.4 fold, thus highlighting the significance of this polymorphism in the development of DVT PMID: 29789989
  3. Monocyte TF may be a relevant source of TF-mediated thrombogenicity in NSCLC patients and may be associated with prognosis in NSCLC. PMID: 28419722
  4. plasma activity higher in women with pre-eclampsia than in those with infants small for gestational age or normal pregnancies PMID: 28521572
  5. The interaction between tissue factor and filamin A is dependent on the differential phosphorylation of Ser253 and Ser258. The interaction with filamin A may translocate cell surface TF to cholesterol-rich lipid rafts, increasing cell surface TF activity as well as TF incorporation and release into microvesicles. PMID: 29044292
  6. Our study identifies a previously undescribed role of miRNA in venous thrombosis by regulating TF expression. Therefore, restoration of miR-145 levels may serve as a promising therapeutic strategy for management of venous thrombosis PMID: 29217135
  7. TF(+) microvesicless released from orthotopic pancreatic tumors increase venous thrombosis in mice. PMID: 28834179
  8. HUVEC and adult human dermal blood endothelial cells respond similarly to TNFalpha and IL-1beta in terms of TF expression, and both are suitable models to examine cell surface TF activity and TF-positive microvesicle release in endothelial cells. PMID: 28151805
  9. Cell lines with intrinsically high TF expression were associated with decreased cancer stem cell activity. Knockdown of TF was associated with increased cancer stem cell activity. Overexpression of TF was associated with decreased cancer stem cell activity. Expression of TF did not affect cellular viability but may increase proliferation. PMID: 29715083
  10. uPAR and TF could potentially be attractive targets for molecular imaging and therapy in oral squamous cell carcinoma due to high positive expression rates and tumor-specific expression patterns. PMID: 28841839
  11. The highest tissue factor activity was detected in microparticles from monocytes, lower activity - in microparticles from endothelial cells and THP-1 cells, and no activity - in microparticles from platelets and granulocytes. PMID: 27926582
  12. These results demonstrate that procoagulant microvesicles shed by head and neck squamous cell carcinoma line (UMSCC81B) induced a procoagulant effect in HUVECs through increased clotting activity and cell membrane surface expression of TF. PMID: 27841803
  13. The proinflammatory cytokine IL-33 induces differential tissue factor expression and activity in monocyte subsets, as well as the release of procoagulant microvesicless. In this manner, IL-33 may contribute to the formation of a prothrombotic state characteristic for cardiovascular disease. PMID: 28492698
  14. Pin1 is a fast-acting enzyme which may be utilised by cells to protect the phosphorylation state of TF in activated cells prolonging TF activity and release, and therefore ensuring adequate haemostasis. PMID: 28962834
  15. Circulating pentraxin nCRP has little pro-angiogenic effect but when dissociated into mCRP on the surface of endothelial cells it is able to trigger potent proangiogenic effects by inducing F3-gene upregulation and TF signaling. PMID: 27808345
  16. In the presence of tissue factor-positive cancer cells, the CAR-modified T cells (TF-CAR T) were highly activated and showed specific cytotoxicity to TF-positive cancer cells. PMID: 28055955
  17. TF is an angiogenic-specific receptor and the target molecule for fVII-targeted therapeutics. PMID: 27807692
  18. The present study did not show significant association of TF gene -603A/G and +5466A>G polymorphisms with venous thromboembolism in malignancy, however, further larger studies including different ethnic population are needed to confirm our findings. PMID: 27685527
  19. It was demonstrated that the nature of the clot formed, as determined from the quartz crystal microbalance parameters, was highly dependent on the rate of clot formation resulting from the TF concentration used for activation. These parameters could also be related to physical clot characteristics such as fibrin fibre diameter and fibre density, as determined by scanning electron microscopic image analysis. PMID: 27311950
  20. Through induction of TF in vascular endothelial cells, IL-33 could enhance their thrombotic capacity and thereby might impact on thrombus formation in the setting of atherosclerosis. PMID: 27142573
  21. Tissue Factor was highly expressed in 73.6 % of osteosarcoma biopsies, and expression associated significantly with disease-free survival. PMID: 26763081
  22. Platelet tissue factor activity and membrane cholesterol are increased in hypercholesterolemia and normalized by rosuvastatin, but not by atorvastatin. PMID: 28142075
  23. the identification of platelet TF and TLR4 as regulators of the effect of E. coli O111 might represent a novel therapeutic target to reduce the devastating consequences of the hemostatic disorder during sepsis. PMID: 28957360
  24. A coagulation initiating pathway is revealed in which the TF-FVIIa-nascent FXa complex activates FVIII apart from thrombin feedback. PMID: 28729433
  25. Ticagrelor, but not clopidogrel, reduces arterial thrombosis via endothelial tissue factor suppression. Ticagrelor reduced TNF-alpha-induced TF expression via proteasomal degradation. PMID: 28028070
  26. The aim of this study was to evaluate the concentration of TF and its inhibitor TFPI in blood plasma, the impact of traditional and non-traditional cardiovascular risk factors on their concentration and the impact of both markers of haemostasis on the severity of subclinical atherosclerosis. PMID: 28749986
  27. TF is highly expressed in breast neoplasms, but does not predict survival or correlate with tumor size. PMID: 28551673
  28. Inhibition of the inflammatory signaling intermediate p38 MAPK reduced tissue factor (TF) mRNA by one third but increased tumor necrosis factor (TNF) and interleukin-1 beta (IL-1beta) mRNA. PMID: 28343272
  29. TF levels were significantly elevated in type 2 diabetes mellitus (both with and without cardiovascular complications) when compared to the controls. We suggest that pathologic plasma TF activity, as marker of increased propensity of clot pathology, should be investigated. PMID: 28246677
  30. our data show that a few select TF residues that are implicated in interacting with PS contribute to the TF coagulant activity at the cell surface. However, our data also indicate that TF regions outside of the putative lipid binding region may also contribute to PS-dependent decryption of TF. PMID: 27348126
  31. These findings suggest that cancer cell-derived extracellular vesicles mediate coagulopathy resulting in ischemic stroke via TF-independent mechanisms. PMID: 27427978
  32. Macrophage tissue factor prothrombotic activity is regulated by integrin-alpha4/arf6 trafficking. PMID: 28495929
  33. this study shows that low levels of circulating tissue factor may contribute to the reduced coagulopathy reported in patients infected with Neisseria meningitidis lpxL1 mutants PMID: 28024455
  34. Oligoubiquitination of Lys255 within TF permits PP2A to bind and dephosphorylate Ser253 and occurs to terminate TF release and contain its activity. PMID: 27599717
  35. Circulating miR-126 exhibits antithrombotic properties via regulating post-transcriptional TF expression, thereby impacting the hemostatic balance of the vasculature in diabetes mellitus. PMID: 27127202
  36. Data suggest that CAIX (carbonic anhydrase IX) is a novel downstream mediator of asTF (alternatively spliced tissue factor) in pancreatic ductal adenocarcinoma, particularly under hypoxic conditions that model late-stage tumor microenvironment; tumor hypoxia appears to lead to up-regulation of CAIX expression (or 'activation'), which is more pronounced in tumor cells overexpressing asTF. PMID: 27721473
  37. Low concentrations of TF and exogenous FXIa, each too low to elicit a burst in thrombin production alone, act synergistically when in combination to cause substantial thrombin production. PMID: 27789475
  38. In placenta of patients with preeclampsia, we detected abnormal expression of F3 and THBD with increased protein and mRNA levels. The role of these molecules in the pathogenesis of this disease and in alterations of hemostatic and histopathological aspects of placentas need further studying. PMID: 27002259
  39. These findings suggest that activation of TF-pathway is an important component of dengue virus-related coagulation disorders. PMID: 27592310
  40. in tumor microenvironment, TF-induced coagulation activated the complement system and subsequently recruited myeloid-derived suppressor cells to promote tumor growth. PMID: 28106852
  41. Hypoxia increased the expression of TF in human podocytes NF-kappaB dependently. TF may have a critical role in the hypoxic podocyte injury. PMID: 26715508
  42. These results reveal a functional link between VWF and TF under whole blood flow conditions, in which surface-immobilized TF and VWF mutually contribute to mural thrombus formation, which is essential for normal hemostasis. By contrast, TF circulating in blood may be involved in systemic hypercoagulability, as seen in sepsis caused by severe microbial infection, in which neutrophil inflammatory responses may be active. PMID: 27562418
  43. TF expression significantly correlated with levels of CRP, TNF-alpha and MCP-1. These factors may play an important role in the development of chronic thromboembolic pulmonary hypertension. PMID: 26667361
  44. Microvesicle-associated tissue factor procoagulant activity, but not plasma TF antigen, may provide valuable additional information for the diagnostic work-up of women with suspected ovarian cancer. PMID: 26967531
  45. This brief review summarizes the contribution of the coagulation system and in particular the role of TF in brain hemostasis as well as to the pathophysiology of stroke and multiple sclerosis. [review] PMID: 27207429
  46. stimulated von Willebrand factor secretion by umbilical vein endothelial cells PMID: 27766025
  47. Circulating FVII, FVIIa and TFPI were significantly elevated in women with severe preeclampsia in the absence of comparable changes in plasma TF levels. PMID: 26765308
  48. The data obtained indicate that active tissue factor, TF is present in membrane microparticles produced in vitro by endothelial cells, monocytes, and THP-1 cells, but not in microparticles derived from granulocytes and platelets. PMID: 27260391
  49. Results indicate that granulocyte-colony stimulating factor receptor, tissue factor, and vascular endothelial growth factor receptor bound vascular endothelial growth factor expression as well as their co-expression might influence breast cancer biology. PMID: 27629739
  50. the actin-binding protein filamin-A has a critical role in incorporation of Tissue factor into extracellular vesicles and secretion of extracellular vesicles from ovarian cancer cells exposed to hypoxia PMID: 26446354

Show More

Hide All

Subcellular Location
[Isoform 1]: Membrane; Single-pass type I membrane protein.; [Isoform 2]: Secreted.
Protein Families
Tissue factor family
Tissue Specificity
Lung, placenta and pancreas.
Database Links

HGNC: 3541

OMIM: 134390

KEGG: hsa:2152

STRING: 9606.ENSP00000334145

UniGene: Hs.62192

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*