Recombinant Human adenovirus B serotype 3 Hexon protein (L3), partial

In Stock
Code CSB-EP334192HIG
Abbreviation Recombinant Human adenovirus B serotype 3 Hexon protein, partial
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
L3
Uniprot No.
Research Area
Microbiology
Alternative Names
Protein II
Species
Human adenovirus B serotype 3 (HAdV-3) (Human adenovirus 3)
Source
E.coli
Expression Region
625-853aa
Target Protein Sequence
MLRNDTNDQSFNDYLSAANMLYPIPANATNIPISIPSRNWAAFRGWSFTRLKTKETPSLGSGFDPYFVYSGSIPYLDGTFYLNHTFKKVAIMFDSSVSWPGNDRLLSPNEFEIKRTVDGEGYNVAQCNMTKDWFLVQMLANYNIGYQGFYIPEGYKDRMYSFFRNFQPMSRQVVDEVNYTDYKAVTLPYQHNNSGFVGYLAPTMRQGEPYPANYPYPLIGTTAVKSVTQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
33.7 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Constructing a plasmid that codes for the human adenovirus B serotype 3 (HAdV-3) Hexon protein (L3) (625-853aa) along with the N-terminal 10xHis-tag gene and C-terminal Myc-tag gene is the initial step to yield the recombinant HAdV-3 Hexon protein. The plasmid is then transferred into E.coli cells. Positive E.coli cells are selected and cultured for protein expression. CUSABIO uses affinity chromatography to purify the protein. The SDS-PAGE analysis is carried out to verify the presence and assess the purity of the protein. The protein possesses a purity exceeding 85%.

Hexon protein is a vital component of adenoviruses, serving as one of the major capsid proteins associated with different viral species or serotypes [1]. It is the most abundant capsid protein, with 240 hexon capsomers, each consisting of a trimer of hexon proteins [2]. Hexon forms a total of 240 trimers on the surface of the icosahedral capsid, making it the most abundant viral capsid protein [3]. The hexon capsomer is an oligomeric protein with three subunits, and its structure and function are influenced by genetic material from specific regions of the viral genome [4]. Furthermore, hexon plays a significant role in the natural liver tropism of adenoviruses [5].

Hexon proteins are essential for inducing the formation of group-specific antibodies and contain major serotype-specific B cell epitopes [6][7]. They are type-specific, and replacing one type of adenovirus hexon with another can alter the neutralizing antigenic properties [8]. The hexon protein is structurally complex, with multiple hypervariable regions containing serotype-specific residues [9]. It is also involved in interactions with scavenger receptors Khare et al. [5] and is crucial for adenovirus assembly, with its nuclear import mediated by protein VI [10].

References:
[1] J. Liu, N. Mei, Y. Wang, X. Shi, & H. Chen, Identification of a novel immunological epitope on hexon of fowl adenovirus serotype 4, Amb Express, vol. 11, no. 1, 2021. https://doi.org/10.1186/s13568-021-01309-2
[2] G. Singh, X. Zhou, Y. Lee, M. Yousuf, M. Ramke, A. Ismailet al., Recombination of the epsilon determinant and corneal tropism: human adenovirus species d types 15, 29, 56, and 69, Virology, vol. 485, p. 452-459, 2015. https://doi.org/10.1016/j.virol.2015.08.018
[3] D. Zhou, T. Wu, K. Emmer, R. Kurupati, S. Tuyishime, Y. Liet al., Hexon-modified recombinant e1-deleted adenovirus vectors as dual specificity vaccine carriers for influenza virus, Molecular Therapy, vol. 21, no. 3, p. 696-706, 2013. https://doi.org/10.1038/mt.2012.248
[4] R. Kauffman and H. Ginsberg, Characterization of a temperature-sensitive, hexon transport mutant of type 5 adenovirus, Journal of Virology, vol. 19, no. 2, p. 643-658, 1976. https://doi.org/10.1128/jvi.19.2.643-658.1976
[5] R. Khare, V. Reddy, G. Nemerow, & M. Barry, Identification of adenovirus serotype 5 hexon regions that interact with scavenger receptors, Journal of Virology, vol. 86, no. 4, p. 2293-2301, 2012. https://doi.org/10.1128/jvi.05760-11
[6] K. Mukantayev, K. Tursunov, D. Kanayev, L. Tokhtarova, Y. Ramankulov, & K. Mukanov, Obtaining strain-producer of recombinant hexon of bovine adenovirus type 3, Eurasian Journal of Applied Biotechnology, no. 1, 2019. https://doi.org/10.11134/btp.1.2019.9
[7] X. Yuan, Y. Wang, W. Jin, B. Zhao, C. Chen, J. Yanget al., Structure-based high-throughput epitope analysis of hexon proteins in b and c species human adenoviruses (hadvs), Plos One, vol. 7, no. 3, p. e32938, 2012. https://doi.org/10.1371/journal.pone.0032938
[8] Y. Wang, Z. Zhang, L. Shang, H. Gao, X. Du, F. Liet al., Immunological study of reconstructed common ancestral sequence of adenovirus hexon protein, Frontiers in Microbiology, vol. 12, 2021. https://doi.org/10.3389/fmicb.2021.717047
[9] L. Crawford-Miksza and D. Schnurr, Analysis of 15 adenovirus hexon proteins reveals the location and structure of seven hypervariable regions containing serotype-specific residues, Journal of Virology, vol. 70, no. 3, p. 1836-1844, 1996. https://doi.org/10.1128/jvi.70.3.1836-1844.1996
[10] H. Wodrich, T. Guan, G. Cingolani, D. Seggern, G. Nemerow, & L. Gerace, Switch from capsid protein import to adenovirus assembly by cleavage of nuclear transport signals, The Embo Journal, vol. 22, no. 23, p. 6245-6255, 2003. https://doi.org/10.1093/emboj/cdg614

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Major capsid protein that self-associates to form 240 hexon trimers, each in the shape of a hexagon, building most of the pseudo T=25 capsid. Assembled into trimeric units with the help of the chaperone shutoff protein. Transported by pre-protein VI to the nucleus where it associates with other structural proteins to form an empty capsid. Might be involved, through its interaction with host dyneins, in the intracellular microtubule-dependent transport of incoming viral capsid to the nucleus.
Subcellular Location
Virion. Host nucleus.
Protein Families
Adenoviridae hexon protein family
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*