Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

Pth

Uniprot No.

P04089

Research Area

Signal Transduction

Alternative Names

Parathyrin

Species

Rattus norvegicus (Rat)

Source

E.coli

Expression Region

32-115aa

Target Protein Sequence

AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNFVSLGVQMAAREGSYQRPTKKEENVLVDGNSKSLGEGDKADVDVLVKAKSQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

16.9 kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The expression region of this recombinant Rat Pth covers amino acids 32-115. The calculated molecular weight for this Pth protein is 16.9 kDa. This Pth protein is produced using e.coli expression system. The Pth gene fragment has been modified by fusing the N-terminal 10xHis tag and C-terminal Myc tag, providing convenience in detecting and purifying the recombinant Pth protein during the following stages.

The rat parathyroid hormone (Pth), produced and released by the parathyroid glands, is a key regulator of calcium and phosphorus homeostasis in the body. Pth acts to increase serum calcium by stimulating the release of calcium from bone, enhancing the reabsorption of calcium in the kidneys, and promoting the activation of vitamin D, which increases intestinal calcium absorption. Pth exerts its effects on bone by stimulating osteoclast activity, leading to the breakdown of bone tissue and the release of calcium into the bloodstream. Pth enhances the reabsorption of calcium in the kidneys while promoting the excretion of phosphate, contributing to the regulation of serum calcium and phosphate concentrations. Understanding the role of rat Pth is essential for grasping the intricacies of mineral metabolism and bone health regulation.

Target Background

Function

PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion. Stimulates [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblastic cells.

Gene References into Functions

PTHrP and PTH mediate wasting through a common mechanism involving PTHR. PMID: 26669699
our data demonstrate that PTH activation of nuclear receptor-associated protein 1 is essential for the effect of PTH to increase FGF23 levels. PMID: 24940803
data support a link between PTH regulating HDAC4 phosphorylation by PKA, trafficking, partial degradation, and the control of MMP-13 transcription through association with Runx2 PMID: 24904057
Mg reduces PTH secretion mainly when a moderate low calcium concentration is present; Mg also modulates parathyroid glands function through upregulation of the key cellular receptors CaR, VDR and FGF23/Klotho system. PMID: 24103811
The persistence of the phosphaturic response to PTH occurs through posttranscriptional mechanisms. PMID: 23344572
The secretory response of parathyroid hormone to acute hypocalcemia in vivo is independent of parathyroid glandular sodium/potassium-ATPase activity. PMID: 21209610
Data suggest that a high concentration of PTH(1-34)-induced cytotoxicity and apoptosis in PC12 cells was associated with upregulation of ERK and p38 through a mitochondria-mediated apoptotic pathway. PMID: 20971569
Study indicates an influence of sex on PTH molecular form secretion or metabolism. PMID: 20627105
Modulation of integrin expression in osteoblastic cells by PTH is likely to be indirect, and phenotypic expression of integrin subtypes is part of the cascade of events that lead to PTH (1-34) mediated osteoblast differentiation. PMID: 11746505
New signaling pathway for parathyroid hormone and cyclic AMP action on extracellular-regulated kinase and cell proliferation in bone cells PMID: 11956184
alterations in PI3K activity in response to parathyroid hormone with aging PMID: 12581861
PTH or PTHrP can exert anabolic effects in the skeleton. PMID: 12631114
that periosteal and endosteal osteoblastic cell populations exhibit metabolic differences in their extracellular matrix responses to PTH PMID: 14514685
the parathyroid hormone-Smad3 axis may have a role in the bone anabolic action of PTH PMID: 14517210
PTH and mechanical stimulation on trabecular bone formation rate suggest a potential benefit for combined PTH administration and exercise in the treatment of osteoporosis. PMID: 14672346
Rho and Rho kinase are an important component of PTH signaling in osteoblastic cells PMID: 15476589
Combinations of radioprotectors may achieve their beneficial additive effects in the growth plate by decreasing the usual early drop in parathyroid hormone-related protein and parathyroid hormone receptor 1 after irradiation PMID: 16494524
Calcium, phosphate & uremia determine parathyroid hormone mRNA stability through binding of protective factors adenosine-uridine rich binding factor 1 & Up-stream of N-ras & recruitment of degradation complex that cleaves parathyroid hormone mRNA[review] PMID: 17565271
FGF23 suppressed both parathyroid hormone (PTH) secretion and PTH gene expression PMID: 17992255
IL-18 is regulated by parathyroid hormone and is required for its bone anabolic actions PMID: 18165223
These data indicate a novel role for KSRP in parathyroid hormone gene expression. PMID: 18583400
Phosphate overload and normal parathyroid hormone infusion induced phenotypic changes in vascular smooth muscle cells, as evidenced by upregulated aortic expression of Runx2. PMID: 19075196
Regulation of PTH mRNA stability by the calcimimetic R568 and the phosphorus binder lanthanum carbonate in chronic kidney disease. PMID: 19129257
without altering the gross chromatin structure, PTH stimulates acetylation of histones H3 and H4 via recruitment of p300 to Runx2 bound to the MMP-13 promoter, resulting in gene activation PMID: 19423655
estrogens regulate PTH indirectly, possibly through FGF23 PMID: 19628670
Parathyroid hormone (PTH) suppresses rat PTH/PTH-related protein receptor gene promoter PMID: 11554727

Hide All

Subcellular Location

Secreted.

Protein Families

Parathyroid hormone family

Tissue Specificity

Hypothalamus and parathyroid gland.

Database Links

KEGG: rno:24694

STRING: 10116.ENSRNOP00000019199

UniGene: Rn.9768

Code	CSB-EP018987RA
Abbreviation	Recombinant Rat Pth protein
MSDS	MSDS Datasheet
Size	$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Rat Parathyroid hormone (Pth)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage