Recombinant Rat Parathyroid hormone (Pth)

In Stock
Code CSB-EP018987RA
Abbreviation Recombinant Rat Pth protein
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Signal Transduction
Alternative Names
Parathyrin
Species
Rattus norvegicus (Rat)
Source
E.coli
Expression Region
32-115aa
Target Protein Sequence
AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNFVSLGVQMAAREGSYQRPTKKEENVLVDGNSKSLGEGDKADVDVLVKAKSQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
16.9 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The expression region of this recombinant Rat Pth covers amino acids 32-115. The calculated molecular weight for this Pth protein is 16.9 kDa. This Pth protein is produced using e.coli expression system. The Pth gene fragment has been modified by fusing the N-terminal 10xHis tag and C-terminal Myc tag, providing convenience in detecting and purifying the recombinant Pth protein during the following stages.

The rat parathyroid hormone (Pth), produced and released by the parathyroid glands, is a key regulator of calcium and phosphorus homeostasis in the body. Pth acts to increase serum calcium by stimulating the release of calcium from bone, enhancing the reabsorption of calcium in the kidneys, and promoting the activation of vitamin D, which increases intestinal calcium absorption. Pth exerts its effects on bone by stimulating osteoclast activity, leading to the breakdown of bone tissue and the release of calcium into the bloodstream. Pth enhances the reabsorption of calcium in the kidneys while promoting the excretion of phosphate, contributing to the regulation of serum calcium and phosphate concentrations. Understanding the role of rat Pth is essential for grasping the intricacies of mineral metabolism and bone health regulation.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion. Stimulates [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblastic cells.
Gene References into Functions
  1. PTHrP and PTH mediate wasting through a common mechanism involving PTHR. PMID: 26669699
  2. our data demonstrate that PTH activation of nuclear receptor-associated protein 1 is essential for the effect of PTH to increase FGF23 levels. PMID: 24940803
  3. data support a link between PTH regulating HDAC4 phosphorylation by PKA, trafficking, partial degradation, and the control of MMP-13 transcription through association with Runx2 PMID: 24904057
  4. Mg reduces PTH secretion mainly when a moderate low calcium concentration is present; Mg also modulates parathyroid glands function through upregulation of the key cellular receptors CaR, VDR and FGF23/Klotho system. PMID: 24103811
  5. The persistence of the phosphaturic response to PTH occurs through posttranscriptional mechanisms. PMID: 23344572
  6. The secretory response of parathyroid hormone to acute hypocalcemia in vivo is independent of parathyroid glandular sodium/potassium-ATPase activity. PMID: 21209610
  7. Data suggest that a high concentration of PTH(1-34)-induced cytotoxicity and apoptosis in PC12 cells was associated with upregulation of ERK and p38 through a mitochondria-mediated apoptotic pathway. PMID: 20971569
  8. Study indicates an influence of sex on PTH molecular form secretion or metabolism. PMID: 20627105
  9. Modulation of integrin expression in osteoblastic cells by PTH is likely to be indirect, and phenotypic expression of integrin subtypes is part of the cascade of events that lead to PTH (1-34) mediated osteoblast differentiation. PMID: 11746505
  10. New signaling pathway for parathyroid hormone and cyclic AMP action on extracellular-regulated kinase and cell proliferation in bone cells PMID: 11956184
  11. alterations in PI3K activity in response to parathyroid hormone with aging PMID: 12581861
  12. PTH or PTHrP can exert anabolic effects in the skeleton. PMID: 12631114
  13. that periosteal and endosteal osteoblastic cell populations exhibit metabolic differences in their extracellular matrix responses to PTH PMID: 14514685
  14. the parathyroid hormone-Smad3 axis may have a role in the bone anabolic action of PTH PMID: 14517210
  15. PTH and mechanical stimulation on trabecular bone formation rate suggest a potential benefit for combined PTH administration and exercise in the treatment of osteoporosis. PMID: 14672346
  16. Rho and Rho kinase are an important component of PTH signaling in osteoblastic cells PMID: 15476589
  17. Combinations of radioprotectors may achieve their beneficial additive effects in the growth plate by decreasing the usual early drop in parathyroid hormone-related protein and parathyroid hormone receptor 1 after irradiation PMID: 16494524
  18. Calcium, phosphate & uremia determine parathyroid hormone mRNA stability through binding of protective factors adenosine-uridine rich binding factor 1 & Up-stream of N-ras & recruitment of degradation complex that cleaves parathyroid hormone mRNA[review] PMID: 17565271
  19. FGF23 suppressed both parathyroid hormone (PTH) secretion and PTH gene expression PMID: 17992255
  20. IL-18 is regulated by parathyroid hormone and is required for its bone anabolic actions PMID: 18165223
  21. These data indicate a novel role for KSRP in parathyroid hormone gene expression. PMID: 18583400
  22. Phosphate overload and normal parathyroid hormone infusion induced phenotypic changes in vascular smooth muscle cells, as evidenced by upregulated aortic expression of Runx2. PMID: 19075196
  23. Regulation of PTH mRNA stability by the calcimimetic R568 and the phosphorus binder lanthanum carbonate in chronic kidney disease. PMID: 19129257
  24. without altering the gross chromatin structure, PTH stimulates acetylation of histones H3 and H4 via recruitment of p300 to Runx2 bound to the MMP-13 promoter, resulting in gene activation PMID: 19423655
  25. estrogens regulate PTH indirectly, possibly through FGF23 PMID: 19628670
  26. Parathyroid hormone (PTH) suppresses rat PTH/PTH-related protein receptor gene promoter PMID: 11554727

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Parathyroid hormone family
Tissue Specificity
Hypothalamus and parathyroid gland.
Database Links
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*