Recombinant Human herpesvirus 6A Envelope glycoprotein B (gB), partial

In Stock
Code CSB-EP338963HJZ
Abbreviation Recombinant Human herpesvirus 6A gB protein, partial
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
gB
Uniprot No.
Research Area
Microbiology
Species
Human herpesvirus 6A (strain Uganda-1102) (HHV-6 variant A) (Human B lymphotropic virus)
Source
E.coli
Expression Region
23-188aa
Target Protein Sequence
DPDHYIRAGYNHKYPFRICSIAKGTDLMRFDRDISCSPYKSNAKMSEGFFIIYKTNIETYTFPVRTYKKELTFQSSYRDVGVVYFLDRTVMGLAMPVYEANLVNSHAQCYSAVAMKRPDGTVFSAFHEDNNKNNTLNLFPLNFKSITNKRFITTKEPYFARGPLWL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
26.8 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human herpesvirus 6A Envelope glycoprotein B (gB) gets produced in an E. coli expression system and spans amino acids 23-188. The partial protein carries an N-terminal 10xHis-tag plus a C-terminal Myc-tag, which helps with purification and detection. SDS-PAGE analysis confirms purity levels above 85%, suggesting reliable performance in experimental work.

Envelope glycoprotein B (gB) from Human herpesvirus 6A appears to play a crucial role in how the virus infects host cells. It mainly contributes to viral entry by promoting membrane fusion. This protein sits within the viral envelope and represents a key target for researchers trying to understand viral pathogenesis and immune response interactions. That makes it potentially valuable for virology studies.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Antibody Development and Characterization

This recombinant HHV-6A gB fragment (aa 23-188) could work as an immunogen or screening antigen when developing monoclonal or polyclonal antibodies against HHV-6A envelope glycoprotein B. The dual His and Myc tags allow for purification and detection across different immunoassay formats. Scientists might use this protein to create antibodies for studying HHV-6A infection mechanisms or viral entry processes. It could also help develop research tools for detecting HHV-6A in lab settings. The partial gB sequence may harbor important epitopes that are relevant for antibody binding studies.

2. Protein-Protein Interaction Studies

Both the N-terminal His tag and C-terminal Myc tag make this protein suitable for pull-down assays aimed at identifying cellular proteins that interact with HHV-6A glycoprotein B. Scientists can attach the protein to nickel-affinity resins or anti-Myc antibody-coated surfaces to capture potential binding partners from cell lysates. These interaction studies might offer insights into HHV-6A entry mechanisms and help identify host cell receptors. The expressed region (aa 23-188) could contain functionally important domains involved in protein-protein interactions.

3. ELISA-Based Binding Assays

The dual-tagged recombinant gB protein appears useful in enzyme-linked immunosorbent assays for studying binding interactions with potential cellular receptors or other viral proteins. His and Myc tags make protein capture and detection straightforward in plate-based assay formats. Scientists can explore binding kinetics, specificity, and competitive binding using this protein as either a capture antigen or detection reagent. Such assays may contribute to understanding HHV-6A tropism and entry mechanisms at the molecular level.

4. Structural and Biochemical Characterization

This recombinant gB fragment works well for biophysical studies aimed at characterizing the structural properties of the HHV-6A envelope glycoprotein B N-terminal region. High purity (>85%) makes it suitable for techniques like circular dichroism spectroscopy, dynamic light scattering, or analytical ultracentrifugation to assess protein folding and oligomerization states. The defined expression region (aa 23-188) allows focused analysis of this specific domain's biochemical properties. These studies could provide fundamental insights into gB structure-function relationships.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Envelope glycoprotein that forms spikes at the surface of virion envelope. Essential for the initial attachment to heparan sulfate moieties of the host cell surface proteoglycans. Involved in fusion of viral and cellular membranes leading to virus entry into the host cell. Following initial binding to its host receptors, membrane fusion is mediated by the fusion machinery composed at least of gB and the heterodimer gH/gL. May be involved in the fusion between the virion envelope and the outer nuclear membrane during virion egress.
Gene References into Functions
  1. In the presence of U24, the TCR/CD3 complex is endocytosed but is not recycled back to the plasma membrane. PMID: 17977973
Subcellular Location
Virion membrane; Single-pass type I membrane protein. Host cell membrane; Single-pass type I membrane protein. Host endosome membrane; Single-pass type I membrane protein. Host Golgi apparatus membrane; Single-pass type I membrane protein.
Protein Families
Herpesviridae glycoprotein B family
Database Links

KEGG: vg:1487917

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*