Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

Uniprot No.

P89053

Research Area

others

Alternative Names

gB; UL55; Envelope glycoprotein B; gB

Species

Rhesus cytomegalovirus (strain 68-1) (RhCMV)

Source

E.coli

Expression Region

745-854aa

Target Protein Sequence

MRQKRAYEKPFEHFFPYVVPPTTVKEAPPSYEQSQYENIKEKAASATKEFSLEEAYQMLLALQKLDQEKRRKAEADDEDFASNGQSAGFLDRLRNRRRGGYQKIQNEYEV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

18.0 kDa

Protein Length

Partial

Tag Info

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The expression region of this recombinant Rhesus cytomegalovirus gB (Envelope glycoprotein B) covers amino acids 745-854. This gB (Envelope glycoprotein B) protein is theoretically predicted to have a molecular weight of 18 kDa. Expression of this gB (Envelope glycoprotein B) protein is conducted in e.coli. The N-terminal 10xHis tag and C-terminal Myc tag was smoothly integrated into the coding gene of gB (Envelope glycoprotein B), which enables a simple process of detecting and purifying the gB (Envelope glycoprotein B) recombinant protein in the following steps.

The Rhesus cytomegalovirus (RhCMV) envelope glycoprotein B (gB) is a key viral protein involved in the entry of the virus into host cells. As a major component of the viral envelope, gB plays a crucial role in the fusion of the viral envelope with the host cell membrane during the initial stages of infection. This fusion process is essential for the delivery of the viral genome into the host cell, facilitating the establishment of a productive infection. Additionally, gB is a prominent target for the host immune response, eliciting the production of antibodies and immune cells aimed at neutralizing the virus. Studying the RhCMV gB provides insights into viral entry mechanisms and immune evasion strategies employed by cytomegaloviruses.

Target Background

Function

Envelope glycoprotein that forms spikes at the surface of virion envelope. Essential for the initial attachment to heparan sulfate moieties of the host cell surface proteoglycans. Involved in fusion of viral and cellular membranes leading to virus entry into the host cell. Following initial binding to its host receptors, membrane fusion is mediated by the fusion machinery composed at least of gB and the heterodimer gH/gL. May be involved in the fusion between the virion envelope and the outer nuclear membrane during virion egress.

Subcellular Location

Virion membrane; Single-pass type I membrane protein. Host cell membrane; Single-pass type I membrane protein. Host endosome membrane; Single-pass type I membrane protein. Host Golgi apparatus membrane; Single-pass type I membrane protein.

Protein Families

Herpesviridae glycoprotein B family

Code	CSB-EP309330RKC
Abbreviation	Recombinant Rhesus cytomegalovirus gB protein, partial
MSDS	MSDS Datasheet
Size	US$306
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Rhesus cytomegalovirus Envelope glycoprotein B (gB), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage