Purity
Greater than 85% as determined by SDS-PAGE.
Alternative Names
gB; UL55; Envelope glycoprotein B; gB
Species
Rhesus cytomegalovirus (strain 68-1) (RhCMV)
Expression Region
745-854aa
Target Protein Sequence
MRQKRAYEKPFEHFFPYVVPPTTVKEAPPSYEQSQYENIKEKAASATKEFSLEEAYQMLLALQKLDQEKRRKAEADDEDFASNGQSAGFLDRLRNRRRGGYQKIQNEYEV
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The expression region of this recombinant Rhesus cytomegalovirus gB (Envelope glycoprotein B) covers amino acids 745-854. This gB (Envelope glycoprotein B) protein is theoretically predicted to have a molecular weight of 18 kDa. Expression of this gB (Envelope glycoprotein B) protein is conducted in e.coli. The N-terminal 10xHis tag and C-terminal Myc tag was smoothly integrated into the coding gene of gB (Envelope glycoprotein B), which enables a simple process of detecting and purifying the gB (Envelope glycoprotein B) recombinant protein in the following steps.
The Rhesus cytomegalovirus (RhCMV) envelope glycoprotein B (gB) is a key viral protein involved in the entry of the virus into host cells. As a major component of the viral envelope, gB plays a crucial role in the fusion of the viral envelope with the host cell membrane during the initial stages of infection. This fusion process is essential for the delivery of the viral genome into the host cell, facilitating the establishment of a productive infection. Additionally, gB is a prominent target for the host immune response, eliciting the production of antibodies and immune cells aimed at neutralizing the virus. Studying the RhCMV gB provides insights into viral entry mechanisms and immune evasion strategies employed by cytomegaloviruses.
