Recombinant Mouse Lymphotoxin-alpha (Lta)

In Stock
Code CSB-EP013218MOa0
Abbreviation Recombinant Mouse Lta protein
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cancer
Alternative Names
Lta; Tnfb; Tnfsf1; Lymphotoxin-alpha; LT-alpha; TNF-beta; Tumor necrosis factor ligand superfamily member 1
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
34-202aa
Target Protein Sequence
LSGVRFSAARTAHPLPQKHLTHGILKPAAHLVGYPSKQNSLLWRASTDRAFLRHGFSLSNNSLLIPTSGLYFVYSQVVFSGESCSPRAIPTPIYLAHEVQLFSSQYPFHVPLLSAQKSVYPGLQGPWVRSMYQGAVFLLSKGDQLSTHTDGISHLHFSPSSVFFGAFAL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
23.8 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Cytokine that in its homotrimeric form binds to TNFRSF1A/TNFR1, TNFRSF1B/TNFBR and TNFRSF14/HVEM. In its heterotrimeric form with LTB binds to TNFRSF3/LTBR. Lymphotoxin is produced by lymphocytes and is cytotoxic for a wide range of tumor cells in vitro and in vivo.
Gene References into Functions
  1. Lymphotoxin alpha has a role in regulating T cell clonal deletion by regulating thymic entry of antigen-presenting cells PMID: 29593265
  2. TNF/Lymphotoxin alpha/beta deficiency influences PM2.5 exposure-induced response of energy metabolism through alterations in both food intake and energy expenditure. PMID: 28917655
  3. Expression of LT alpha and beta on acinar cells in mice led to chronic pancreatitis and sufficed to reproduce key features of human autoimmune pancreatitis including the development of autoimmunity and AIP associated secondary extra pancreatic pathologies. PMID: 24508087
  4. These data highlight a previously undiscovered role of RORgammat(+) ILCs for NK cell development and define LT from ILCs as an essential molecule for the stromal microenvironment supporting NK cell development PMID: 24913234
  5. These data demonstrate that lymphotoxin-expressing cells, such as Th1 cells, mediate stromal keratitis. PMID: 23850656
  6. TNFalpha and LTalpha mediate post-myocardial infarction cardiac dysfunction via TNFR1 stimulation, whereas TNFR2 activation is cardioprotective against ischemic injury. PMID: 23704873
  7. findings show that soluble lymphotoxin alpha (sLTalpha3) produced by RORgammat(+) innate lymphoid cells controls T cell-dependent IgA induction in the lamina propria via regulation of T cell homing to the gut PMID: 24311691
  8. Data suggest that among many cytokines increased after myocardial ischemia/reperfusion (MI/R), lymphotoxin-alpha (Lta) is the only cytokine remaining elevated 24-72 h after reperfusion; LTa appears to suppress adiponectin expression following MI/R. PMID: 23360826
  9. study reports that mice deficient in lymphotoxin, a key molecule in gut immunity, were resistant to diet-induced obesity PMID: 22922363
  10. Data from lymphotoxin-alpha knockout mice suggest that lymphotoxin-alpha contributes to diet-induced weight gain and adiposity (leading to obesity) and is required to modulate accumulation of immune cells in adipose tissue (as in obesity). PMID: 22318945
  11. isolated a lysine-deficient mutant LTalpha, LT-K0, with almost identical bioactivity to that of wtLTalpha against mouse LM cells PMID: 21871814
  12. Grafts deficient in lymphotoxin-alpha have an attenuated capacity to induce graft-versus-host disease. PMID: 19789388
  13. LTalpha plays a significant role in lymphatic vessel function and in inflammation-associated lymphangiogenesis PMID: 20566898
  14. Our findings suggest a contribution of lymphotoxin alpha in the control of chronic M. tuberculosis infection. PMID: 20817877
  15. Data show show that targeted mutation of the lymphotoxin alpha (LTalpha) gene efficiently rescued tumor-reactive T cells, drastically reduced cancer incidence, and almost completely ablated metastasis. PMID: 19805094
  16. The organogenesis of nasal-associated lymphoid tissue (NALT) occurs independently of lymphotoxin alpha; however, the organization and recruitment of lymphocytes within NALT are dependent on LT alpha. PMID: 11801629
  17. Loss of lymphotoxin-alpha but not tumor necrosis factor-alpha reduces atherosclerosis in mice PMID: 11809756
  18. Control of experimental Trypanosoma brucei infections occurs independently of lymphotoxin-alpha induction. PMID: 11854219
  19. role in T-cell activation during an acute infection with lymphocytic choriomeningitis virus (LCMV) PMID: 11907234
  20. Locally up-regulated lymphotoxin alpha, not systemic tumor necrosis factor alpha, is the principle mediator of murine cerebral malaria. PMID: 12021316
  21. TNF-alpha and LT-alpha-deficient mice exhibit significantly improved morbidity and mortality during zymosan-induced MODS PMID: 12069182
  22. LT-alpha-deficient mice can generate antigen-specific CD8 T cells in response to infection with influenza A virus; however, appearance of the immune response is delayed for 2 to 3 days. PMID: 12391242
  23. Regulates spleen white pulp structure and function. (REVIEW) PMID: 12405187
  24. TNF-alpha and lymphotoxin-alpha are required for loss of BM B lineage cells during respiratory infection with influenza virus. PMID: 12444124
  25. microenvironment in peripheral lymphoid organs associated with lymphotoxin alpha/lymphotoxin beta-lymphotoxin beta receptor signaling and chemokine production is critical for recruitment efficiency of dendritic cells PMID: 12560241
  26. role in lymphoid organ neogenesis PMID: 12732657
  27. Formation of isolated lymphoid follicles (ILFs) in the small intestine is dependent upon LT; interactions of LT with its receptor LT beta-R are not required for ILF during gestation and can occur in adults. PMID: 12759424
  28. Compared with wild type mice, deficiency of lymphotoxin-alpha and/or TNF results in reduced production of inducible NO synthase, failure to control Toxoplasma gondii in the brain, and impaired toxoplasmastatic activity of macrophages. PMID: 12794148
  29. membrane LT-alpha is important in resistance to Theiler's virus infection PMID: 12882833
  30. Since Ltalpha is detrimental in inflammation and demyelination, but not necessary for remyelination and repair, inhibiting Ltalpha signaling may represent a promising strategy to treat MS. PMID: 15382206
  31. Lymphotoxin alpha- and lymphotoxin beta receptor-dependent interactions are required to initiate postnatal development of small intestinal lymphoid aggregates. PMID: 15585839
  32. Contributes to nasal-associated lymphoid tissue development and function through regulation of lymphoid chemokines and adhesion molecules. PMID: 15632007
  33. The lymphotoxin alpha signaling pathway is an essential effector pathway for host defense against the beta-herpesvirus muromegalovirus (MCMV). PMID: 15905567
  34. Blockade of the LT signaling pathway exacerbates the development and progression of collagen-induced arthritis, probably by skewing the Th1/Th2 balance that determines the outcome of autoimmune responses PMID: 16200624
  35. High cholesterol diet causes an abnormal metabolic phenotype (hepatic steatosis) in the absence of TNFbeta signal. PMID: 16406654
  36. The phenotype of the new LTalphaDelta/Delta mice indicates that LTalpha plays a smaller role in lymphoid organ maintenance than previously thought and has no direct role in the regulation of TNF expression. PMID: 16705172
  37. Data show that signaling of lymphotoxin (LT) alphabeta through the LTbeta receptor (LTbetaR) is indispensable for regulating peripheral but not thymic Valpha14i NKT cell numbers. PMID: 16751279
  38. Ectopic expression of type II collagen (CII)in medullary thymic epithelial cells and the corresponding central tolerance to CII are lymphotoxin dependent. PMID: 16785524
  39. Lymphotoxin alpha and tumour necrosis factor are not required for control of parasite growth, but differentially regulate cytokine production during Plasmodium chabaudi chabaudi AS infection. PMID: 17266742
  40. Expression of lymphotoxin-alphabeta on antigen-specific T cells is required for dendritic cell function. PMID: 17452522
  41. Lymphotoxin alphabeta2 (membrane lymphotoxin) plays a critical role in resistance to Leishmania major by promoting effective T cell-mediated anti-Leishmania immunity. PMID: 17911622
  42. A subtle function of the newly identified lymphotoxin alpha-Troy pathway is revealed in skin appendage development. PMID: 18202551
  43. The postnatal development of the splenic white pulp, involving the influx of T cells, depends on LTalpha1beta2 expressed by B cells. PMID: 18403646
  44. Data suggest that although lymphotoxin-alpha does not contribute significantly to the resistance and host responses of mice to airborne type A F. tularensis infection, it does play a subtle role in the multiplication/dissemination of F. tularensis. PMID: 18769490
  45. The adaptive immune system directly regulates liver regeneration via a T cell-derived lymphotoxin axis (LTalpha, LTbeta, LTbetaR). PMID: 18952083
  46. cigarette smoke induces pulmonary expression of lymphoid chemokines CXCL13 and CCL19 in a LTalphabeta-LTbetaR-dependent fashion PMID: 19164352
  47. both LTalpha and tumor necrosis factor are essential for the regulation of the granuloma, but they have distinctive roles in the recruitment of lymphocytes and maintenance of the granulomatous response during chronic M. leprae infection. PMID: 19246648
  48. LTalpha(1)beta(2) and LTbeta receptor signals control development and maintenance of the mature marginal sinus(MS)structure and implicate MAdCAM-1 in the structuring of the MS endothelial cells that is important for movement of immune cells in the spleen. PMID: 19303389
  49. Sustained LT signaling represents a pathway involved in hepatitis-induced hepatocellular carcinoma. PMID: 19800575

Show More

Hide All

Subcellular Location
Secreted. Membrane.
Protein Families
Tumor necrosis factor family
Database Links
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*