Recombinant Human Beta-nerve growth factor(NGF),partial

In Stock
Code CSB-AP003951HU
Product Type Growth Factor
Size US$39
Uniprot No. P01138
Lead Time 5-10 business days
Storage Buffer Lyophilized from a 0.2 μm filtered 20 mM PB, 250 mM NaCl, pH 7.0
Alias Beta-Nerve Growth Factor; Beta-NGF; NGF; NGFB
Species Homo sapiens (Human)
Biological_Activity The ED50 as determined in a cell proliferation assay using TF?1 human erythroleukemic cells is less than 2 ng/ml.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVR
Research Area Neuroscience
Source Mammalian cell
Gene Names NGF
Expression Region 122-239aa
Tag Info Tag-Free
Mol. Weight 13.5 kDa
Protein Description Partial
Still Have Questions? Leave a Message or Start an on-line Chat
Function Nerve growth factor is important for the development and maintenance of the sympathetic and sensory nervous systems. Extracellular ligand for the NTRK1 and NGFR receptors, activates cellular signaling cascades through those receptor tyrosine kinase to regulate neuronal proliferation, differentiation and survival. Inhibits metalloproteinase dependent proteolysis of platelet glycoprotein VI
Involvement in disease Neuropathy, hereditary sensory and autonomic, 5 (HSAN5)
Subcellular Location Secreted
Protein Families NGF-beta family
Database Links

HGNC: 7808

OMIM: 162030

KEGG: hsa:4803

STRING: 9606.ENSP00000358525

UniGene: Hs.2561

Pathway MAPK signaling pathway
PI3K-Akt signaling pathway
Apoptosis
Ras signaling pathway
Rap1 signaling pathway
Inflammatory Pain
Inhibitors of axonal regeneration

Related Products

NGF Antibodies

NGF Antibodies for Homo sapiens (Human)

NGF Antibodies for

NGF Antibodies for Human

NGF Proteins

NGF Proteins for Homo sapiens (Human)

NGF ELISA Kit

NGF ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.