Recombinant Influenza A virus Matrix protein 2 (M2)

In Stock
Code CSB-CF3574GMC
Abbreviation Recombinant Influenza A virus M2 protein
MSDS
Size $1620
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
M2
Uniprot No.
Research Area
Immunology
Alternative Names
Proton channel protein M2
Species
Influenza A virus
Source
in vitro E.coli expression system
Expression Region
1-97aa
Target Protein Sequence
MSLLTEVETPTRSGWECRCSDSSDPLVIAANIIGILHLILWITDRLFFKCIYRRFKYGLKRGPSTEGVPESMREEYQQEQQSAVDVDDGHFVNIELE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
18.6kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Influenza A virus Matrix protein 2 (M2) is produced through an in vitro E.coli expression system, covering the complete 1-97 amino acid sequence. The protein comes with an N-terminal 10xHis-tag and a C-terminal Myc-tag, which makes purification and detection more straightforward. SDS-PAGE analysis shows purity levels exceeding 85%. This research-use-only product works well for experimental applications that need high-quality viral proteins.

The Matrix protein 2 (M2) of Influenza A virus appears to play a critical role in the virus's life cycle, especially during viral uncoating and assembly. It works as an ion channel, which seems vital for acidifying the viral interior—a process necessary for genome release. M2 has become a key target in antiviral research and may provide valuable insights into how influenza virus replication and pathogenesis actually work.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, the recombinant Influenza A virus M2 protein is unlikely to be correctly folded or bioactive. M2 is a transmembrane protein that requires proper insertion into a lipid bilayer for correct folding and oligomerization into a functional tetrameric proton channel. The cell-free E. coli expression system lacks a membrane environment and eukaryotic chaperones, which are essential for transmembrane protein folding. The dual tags (N-terminal 10xHis and C-terminal Myc) may further disrupt the protein's structure, as the tags could interfere with the transmembrane domain or oligomerization sites. The purity of >85% indicates some impurities, but does not guarantee proper folding. Without experimental validation (e.g., circular dichroism for secondary structure, proton channel activity assays, or oligomerization checks), the protein cannot be assumed to be functional.

1. Antibody Development and Characterization

This recombinant M2 protein can be used for antibody development, but if misfolded, antibodies may primarily recognize linear epitopes or tag-derived sequences rather than conformational epitopes of native M2. The dual tags may dominate the immune response, reducing specificity for viral M2. If correctly folded, antibodies might recognize native M2; however, without folding validation, antibodies should be validated against full-length, properly folded M2 or viral particles to ensure relevance. The full-length sequence is advantageous but does not guarantee correct conformation.

2. Protein-Protein Interaction Studies

The dual-tagged M2 protein can be employed in pull-down assays, but if misfolded, interactions may be tag-mediated or non-specific, leading to false positives. The tags allow immobilization, but biologically relevant binding partners (e.g., host factors during infection) may not bind without native conformation. If used, validate folding first and include controls (e.g., tag-only proteins or inactive mutants) to distinguish specific interactions. Results should be confirmed with eukaryotic-expressed M2.

3. Biochemical and Structural Analysis

This recombinant M2 is unsuitable for meaningful structural analysis without folding validation and tag removal. The tags may alter biophysical properties (e.g., in circular dichroism or dynamic light scattering), and the lack of a membrane environment means data may not reflect native structure. If misfolded, stability or oligomerization studies will be invalid. For reliable insights, use membrane-reconstituted M2 and remove tags for high-resolution techniques like crystallography.

4. Assay Development and Screening Applications

The dual-tagged M2 can be used as a standard in assays (e.g., ELISA or Western blot), but the tags may affect antibody binding, leading to inaccurate quantification. If misfolded, it may not serve as a reliable positive control for native M2 detection. For screening applications (e.g., small molecule interactions), validate that the protein's conformation mimics native M2. Use with caution and include controls to account for tag interference.

Final Recommendation & Action Plan

To ensure reliable results, first validate the folding and bioactivity of the recombinant M2 protein using techniques such as circular dichroism to assess secondary structure, size-exclusion chromatography or blue native PAGE to check oligomerization, and proton flux assays to confirm channel activity. Given the challenges of expressing transmembrane proteins in cell-free systems, consider using eukaryotic expression (e.g., mammalian cells) for functional studies. If using this protein, remove the tags via proteolytic cleavage and reconstitute the protein in liposomes for biochemical assays. For antibody development, validate antibodies with native M2 from viral particles. In all applications, include appropriate controls, such as tag-free proteins and known inhibitors, to minimize artifacts. Prioritize folding validation before any functional or immunological studies.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*