Recombinant Mouse Myelin-oligodendrocyte glycoprotein (Mog), partial

In Stock
Code CSB-EP726763MO3
Abbreviation Recombinant Mouse Mog protein, partial
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Neuroscience
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
29-156aa
Target Protein Sequence
GQFRVIGPGYPIRALVGDEAELPCRISPGKNATGMEVGWYRSPFSRVVHLYRNGKDQDAEQAPEYRGRTELLKETISEGKVTLRIQNVRFSDEGGYTCFFRDHSYQEEAAMELKVEDPFYWVNPGVLT
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
20.6 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Minor component of the myelin sheath. May be involved in completion and/or maintenance of the myelin sheath and in cell-cell communication. Mediates homophilic cell-cell adhesion.
Gene References into Functions
  1. The aim of this work was to explore the conformational characteristics of rat/mouse MOG35-55 immunodominant epitope. The results are discussed in terms of rational design of altered peptide ligands or non-peptide mimetics based on rat MOG35-55 that could be served as potential inhibitors of experimental autoimmune encephalomyelitis PMID: 27483998
  2. Identify nerve growth factor as a binding partner for MOG and demonstrate that this interaction is capable of sequestering NGF from TrkA-expressing neurons to modulate axon growth and survival. PMID: 26347141
  3. the absence of N-glycan did not interfere with MOG's subcellular localization and it did not result in activation of endoplasmic reticulum stress. PMID: 25541284
  4. Data indicate that in mixed chimeras with bone marrow-encoding myelin oligodendrocyte glycoprotein (MOG), the development of MOG-specific B cells was abrogated, resulting in a lack of MOG-specific B cells in all B cell compartments examined. PMID: 24532581
  5. Different forms of evolution of optic neuritis are observed in this animal model suggest that variations of biosynthetic MOG35-55 peptide concentration are capable of inducing different profiles of optic neuritis. PMID: 24083391
  6. Identify immunogenic/encephalitogenic T-cell epitopes within MOG capable of inducing experimental autoimmune encephalomyelitis in C57BL/6 mice. PMID: 23876060
  7. PLP significantly suppresses both models of experimental autoimmune encephalitis (EAE)even when there is some evidence of epitope spreading in the myelin oligodendrocyte (MOG)38-50-induced EAE model. PMID: 23911075
  8. CNTF may play a role in the process of remyelination by inducing the MOG expression. PMID: 23443463
  9. MOG-specific CD4-positive T cells accumulate within the chemokine-expressing draining lymph nodes, rather than within the brain or spinal cord during induction of autoimmune encephalomyelitis. PMID: 22287719
  10. This study provides valuable information about requirements of anti-myelin oligodendrocyte glycoprotein reactivity for being regarded as a prognostic biomarker in a subtype of MS. PMID: 22093619
  11. Mice immunized with encephalitogenic myelin oligodendrocyte glycoprotein MOG(35-55) peptide develop significant serum levels of anti-MOG antibodies in parallel with disease progression. PMID: 21993076
  12. B cell-deficient mice exhibit reduced medullary thymic epithelial cell numbers and reduced MOG mRNA expression. PMID: 21550671
  13. Cell surface targeting of MOG is not disrupted in the absence of the endoplasmic reticulum chaperones. PMID: 21172390
  14. MOG self-tolerance modulates the encephalitogenic potential of autoreactive MOG T cells in the periphery. PMID: 14624757
  15. The core epitope of immunodominant 35-55 peptide (pMOG) fragment has the potential to be citrullinated at two T cell receptor contact residues 41-Arg and 46-Arg, allowing an expanded repertoire of T cells to contribute to encephalomyelitis etiopathology. PMID: 20164413
  16. lack of systemic complement at the time of induction of EAE delays the onset and attenuates the course of the disease most probably via diminishing the response of MOG-specific T cells and production of autoantibodies PMID: 19201476
  17. The encephalitogenic peptide of intact MOG protein (resides 35-55) must be processed and presented via a functioning class II-restricted antigen processing pathway in the central nervous system in order to initiate autoimmune demyelinating disease. PMID: 11937578
  18. role in development of spontaneous autoimmune optic neuritis PMID: 12732654
  19. MOG has a role in immune tolerance and in experimental autoimmune encephalomyelitis PMID: 12925695
  20. Treatment of oligodendrocytes with anti-MOG leads to an increase in calcium influx and activation of the MAPK/Akt pathways. PMID: 15634682
  21. Opticospinal encephalomyelitis mice B cells bind high dilutions of recombinant MOG, but not MOG peptide, and process and present it to autologous T cells. PMID: 16955140
  22. Ig heavy chainMOG mice spontaneously develop a severe form of experimental autoimmune encephalomyelitis. PMID: 16955141
  23. prevention of experimental autoimmune encephalomyelitis by treatment with embryonic stem cell-derived dendritic cells(ES-DC)-TRAIL/MOG is mediated by MOG-reactive CD4(+)CD25(+) Treg propagated by ES-DC-TRAIL/MOG PMID: 17202353
  24. Results describe T cell receptor (TCR) transgenic mice (relapsing-remitting [RR] mice) carrying a TCR specific for myelin oligodendrocyte glycoprotein (MOG) peptide 92-106. PMID: 19487416
  25. CD8+ T cells reactive to MOG37-46 are pro-inflammatory and traffic to the CNS; however, the presence of CD4+ T cells elicits more severe disease and sustained inflammation of the CNS. PMID: 19540601
  26. the ligation of CEACAM1 negatively regulates the severity of experimental autoimmune encephalomyelitis by reducing MOG(35-55)-specific induction of both interferon-gamma and interleukin-17 via invariant natural killer T cell-dependent mechanisms PMID: 19700760
  27. protein localization signal PMID: 11389181

Show More

Hide All

Subcellular Location
Membrane; Multi-pass membrane protein.
Protein Families
Immunoglobulin superfamily, BTN/MOG family
Tissue Specificity
Found exclusively in the CNS, where it is localized on the surface of myelin and oligodendrocyte cytoplasmic membranes. Reduced expression levels are observed in jimpy and quacking dysmyelinating mutant mice.
Database Links
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*