Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Mouse Ttr at 5 μg/mL can bind Mouse Rbp4 (CSB-MP4018MO), the EC50 is 17.06-26.23 ng/mL.
Molecular Characterization
Species
Mus musculus (Mouse)
Expression Region
21-147aa
Target Protein Sequence
GPAGAGESKCPLMVKVLDAVRGSPAVDVAVKVFKKTSEGSWEPFASGKTAESGELHGLTTDEKFVEGVYRVELDTKSYWKTLGISPFHEFADVVFTANDSGHRHYTIAALLSPYSYSTTAVVSNPQN
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
This Recombinant Mouse Transthyretin (Ttr) was produced in mammalian cell, where the gene sequence encoding mouse Ttr (21-147aa) was expressed with the C-terminal 10xHis tag. The purity of this Ttr protein was greater than 95% by SDS-PAGE. The activity was validated.
Transthyretin (TTR), also known as vitamin A-binding protein, prealbumin, and thyroid-binding prealbumin, is mainly secreted by the liver and distributed in plasma and cerebrospinal fluid. The main function of TTR in the body is to participate in the transport of thyroxine and retinol, and maintain the normal levels of retinol, thyroxine and retinol-binding protein in the body. TTR can sensitively reflect the nutritional status and pathological changes of the body. It has been proved that TTR is related to various diseases of the human body, such as familial thyroid amyloidosis and diabetes. And many studies have also shown that the expression of TTR in the plasma and tumor cells of patients with various tumors is abnormal, so TTR is considered as one of the candidate tumor markers.
