Recombinant Mouse Transthyretin(Ttr),partial

In Stock
Code CSB-EP025270MO1e0
Product Type Recombinant Protein
Size US$2466Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. P07309
Lead Time 3-7 business days
Relevance Thyroid hormone-binding protein. Probably transports thyroxine from the bloodstream to the brain.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Prealbumin
Species Mus musculus (Mouse)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence AGAGESKCPLMVKVLDAVRGSPAVDVAVKVFKKTSEGSWEPFASGKTAESGELHGLTTDEKFVEGVYRVELDTKSYWKTLGISPFHEFADVVFTANDSGHRHYTIAALLSPYSYSTTAVVSNPQN
Research Area Neuroscience
Source E.coli
Gene Names Ttr
Expression Region 23-147aa
Tag Info N-terminal GST-tagged
Mol. Weight 40.5kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Thyroid hormone-binding protein. Probably transports thyroxine from the bloodstream to the brain.
Subcellular Location Secreted
Protein Families Transthyretin family
Tissue Specificity Detected in plasma (at protein level). Detected in liver.
Database Links

KEGG: mmu:22139

STRING: 10090.ENSMUSP00000074783

UniGene: Mm.2108

Pathway Th17 cell differentiation
Thyroid hormone synthesis

Related Products

Ttr Antibodies

Ttr Antibodies for Mus musculus (Mouse)

Ttr Antibodies for Mouse

Ttr Proteins

Ttr Proteins for Mus musculus (Mouse)

Ttr ELISA Kit

Ttr ELISA Kit for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.