Recombinant Mouse Transthyretin (Ttr), partial

In Stock
Code CSB-YP025270MO1
Abbreviation Recombinant Mouse Ttr protein, partial
MSDS
Size $368
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cardiovascular
Alternative Names
Ttr; Transthyretin; Prealbumin
Species
Mus musculus (Mouse)
Source
Yeast
Expression Region
23-147aa
Target Protein Sequence
AGAGESKCPLMVKVLDAVRGSPAVDVAVKVFKKTSEGSWEPFASGKTAESGELHGLTTDEKFVEGVYRVELDTKSYWKTLGISPFHEFADVVFTANDSGHRHYTIAALLSPYSYSTTAVVSNPQN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
15.5 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Mouse Transthyretin (Ttr) is produced through a yeast expression system and covers amino acids 23 to 147. This partial-length protein comes with an N-terminal 6xHis-tag, which makes purification more straightforward. The product shows purity levels above 90%, as determined by SDS-PAGE analysis. It's designed strictly for research purposes and shouldn't be used in clinical or diagnostic settings.

Transthyretin functions as a transport protein, mainly carrying thyroid hormones and retinol-binding protein-bound retinol through the bloodstream. The protein appears to play an important role in keeping thyroid hormones and vitamin A levels balanced. Given its involvement in these vital processes, transthyretin has become a key focus in biomedical research—especially when scientists want to understand how it's structured and what it does.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Mouse Ttr is a tetrameric protein that requires precise folding, proper tetramerization, and specific tertiary structure for its functional activity in thyroxine transport. The yeast expression system provides a eukaryotic folding environment that supports disulfide bond formation and proper oligomerization. The N-terminal 6xHis-tag is relatively small and may cause minimal steric interference. The partial fragment (23-147aa) represents the mature protein without the signal peptide and should contain the complete monomeric unit. However, the probability of correct folding with functional tetramerization activity requires experimental validation.

1. In Vitro Protein-Protein Interaction Studies

This application carries a moderate risk. TTR interactions with binding partners (e.g., RBP) require proper tetramerization. If correctly folded and tetrameric (verified), the protein may identify physiological interactions; if misfolded/unverified, there is a risk of non-specific binding. The His-tag generally doesn't interfere with most interaction interfaces.

2. Antibody Development and Validation

This application is highly suitable. Antibody development relies on antigenic sequence recognition. The yeast-expressed protein provides proper folding and potential post-translational modifications, making it an excellent immunogen for generating TTR-specific antibodies.

3. Structural and Biophysical Characterization

These studies are essential for determining folding status. Techniques should include size-exclusion chromatography (to assess tetramer formation), circular dichroism spectroscopy, and thermal stability assays. The yeast expression system likely supports proper folding for meaningful structural analysis.

4. Comparative Species Analysis

Meaningful comparative studies require a native tetrameric structure. If correctly folded and tetrameric (verified), the protein enables valid evolutionary comparisons; if misfolded/unverified, comparative analyses would be misleading.

Final Recommendation & Action Plan

The yeast-expressed TTR with a small His-tag has a high probability of correct folding and tetramerization due to the eukaryotic expression system. Begin with Application 3 (Structural Characterization) to validate tetramer formation through size-exclusion chromatography and analytical ultracentrifugation. Applications 1 and 4 require this validation before proceeding. Application 2 (antibody development) can proceed immediately. The yeast expression system is particularly suitable for this secretory protein that naturally undergoes tetramerization.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Thyroid hormone-binding protein. Probably transports thyroxine from the bloodstream to the brain.
Gene References into Functions
  1. A C57BL/6 mouse line carrying the transthyretin (TTR) Gly83Arg gene mutation was successfully established. This strain of mice can be used for the study of hereditary vitreous amyloidosis. PMID: 29360446
  2. Results indicate that TTR stability is important for its recently described functions in assisting Abeta transport at the BBB and at the liver and also in regulating LRP1 levels and activity. TTR stabilization can serve as an avenue to increase both Abeta elimination and LRP1 levels, which in turn will further participate in Abeta clearance. PMID: 28570028
  3. This study reports a possible mechanism for Rhabdomyolysis-Induced Acute Kidney Injury and suggests that reductions in TTR could increase the generation of Reactive Oxygen Species and induce apoptosis. PMID: 29040977
  4. TTR neuritogenic activity is mediated by the megalin receptor and is lost in megalin-deficient neurons. PMID: 27518433
  5. New insights into ghrelin cell physiology, and given the known functions of RBP4 and TTR, support an emerging role for the ghrelin cell in blood glucose handling and metabolism. PMID: 23840311
  6. Transthyretin (TTR) deposition in the peripheral nervous system is the hallmark of familial amyloidotic polyneuropathy (FAP). PMID: 27568093
  7. TTR mediated transport of thyroxine represents a survival mechanism necessary for the myogenic program. PMID: 28075349
  8. provide evidence of a new role of Transthyretin as a transcription inducer of insulin-like growth factor receptor I in central nervous system, unveiling a new role in neuroprotection PMID: 25084758
  9. data also indicate that it is unlikely that the behaviors seen in Ttr(-/-) mice are related to its function PMID: 24956283
  10. Native transthyretin inhibits all preeclampsia-like features in the humanized mouse model. PMID: 24035612
  11. Transthyretin silencing (TTRkd) significantly reduced myogenin expression. PMID: 23717457
  12. Amyloid fibrils formed by a mutant form of TTR, A25T, activate microglia, leading to the secretion of tumor necrosis factor-alpha (TNF-alpha), interleukin-6 (IL-6) and nitric oxide. PMID: 24008733
  13. Hsf-1 affects podocyte markers NPHS1, NPHS2 and WT1 in a transgenic mouse model of TTRVal30Met-related amyloidosis. PMID: 23829269
  14. Fibroblasts endocytose and degrade transthyretin aggregates in transthyretin-related amyloidosis. PMID: 23817086
  15. Increased degradation of 14-3-3zeta in lysosomes in the absence of TTR, increasing autophagy. PMID: 23523922
  16. our data demonstrate that the increased expression of Ttr in ob/ob mice does not cause (but rather attenuates) their phenotypic abnormalities. PMID: 22849972
  17. TTR has an important and nonredundant role in influencing the development of several organs. PMID: 23092911
  18. Results suggest that TTR expressed in pancreatic alpha cells may play important roles in glucose homeostasis via regulating the expression of glucagon. PMID: 23108050
  19. TTR binds to Grp78 at the plasma membrane, is internalized into the beta-cell via a clathrin-dependent pathway, and that this internalization is necessary for the effects of TTR on beta-cell function. PMID: 22183612
  20. the expression of transthyretin and protein kinase Cgamma were increased in the prefrontal cortex but not in the hippocampus of naltrexone-treated mice PMID: 21111029
  21. Cerebrospinal fluid transthyretin contributes to control of neuronal cell death, edema and inflammation which influences the survival of endangered neurons in cerebral ischemia. PMID: 21044072
  22. Results identify transthyretin and Klotho as physiological targets of amyloid precursor protein that are regulated by soluble APPsbeta independent of developmental APP functions. PMID: 20855613
  23. TTR mRNA is dramatically up-regulated in the preimplantation mouse uterus as well as the progesterone-treated ovariectomized mouse uterus. PMID: 20188365
  24. Using transthyretin (TTR) KO mice as a model of augmented NPY levels, we showed that this strain has increased NPY content in the bone, further validating the expression of this neuropeptide by bone cells. PMID: 19954489
  25. Transthyretin is not required for thyroid hormone access to or distribution within the mouse brain. PMID: 12182890
  26. Levels of noradrenaline were significantly increased in the limbic forebrain of TTR-null mice. This report represents the first clear indication that TTR plays a role in behaviour, probably by modulation of the noradrenergic system PMID: 15009661
  27. Mice overexpressing mutant APP have high levels of sAPPalpha & transthyretin & do not develop the tau phosphorylation or neuronal loss characteristic of human AD. Anti-transthyretin antibodies reverse this, showing that transthyretin is neuroprotective. PMID: 15342738
  28. Transthyretin is clearly not produced in the brain parenchyma of wild-type mice nor in transgenic mouse models of Alzheimer's disease. PMID: 16698124
  29. The effect of chronic ethanol treatment on transthyretin expression was analyzed because gamma-PKC mutants do not develop tolerance to chronic ethanol treatment. PMID: 16767509
  30. proliferation and apoptosis in the SVZ neural stem cell niche are differentially affected by the lack of TTR synthesis. PMID: 17574756
  31. Our results strongly suggest that TTR plays a critical role in modulating Abeta deposition in vivo. PMID: 17596449
  32. the absence of transthyretin does not seem to influence the regulation of lipid and glucose metabolism PMID: 17611908
  33. data show that the absence of TTR seems to accelerate the poorer cognitive performance normally associated with aging PMID: 17698379
  34. TTR participates in nerve physiology and enhances nerve regeneration PMID: 17897357
  35. Lowering TTR levels or interfering with retinol binding protein 4-TTR binding may enhance insulin sensitivity in obesity and type 2 diabetes PMID: 18285525
  36. TCDD can induce memory deficits by altering the estrogen pathways and a main route of TTR-mediated retinol transport. PMID: 18294692
  37. In mouse DRG, TTR mRNA was localized in the peripheral glial cells. PMID: 18406527
  38. Data show that the degree of total and vascular Abeta burdens in the aged Tg2576/TTR(-/-) mice is significantly reduced relative to the age-matched Tg2576/TTR(+/-) mice. PMID: 18429966
  39. TTR deposited in peripheral nervous system of familial amyloiditic polyneuropathy should be regarded as having blood or CSF origin PMID: 18835560
  40. Results suggest that transthyretin is up-regulated by estradiol via a pathway involving estrogen receptors alpha and beta. PMID: 19130215
  41. TTR has natural substrates in the nervous system PMID: 19138167
  42. Transthyretin, a gene previously suggested to play a role in the reduction of Alzheimer disease, has been identified as a leftward gene asymmetrically expressed in the brains of adult male mice. PMID: 19167467
  43. Axonal retrograde transport is impaired in transthyretin knock-out mice, in addition to neurite outgrowth impairment. PMID: 19279259
  44. Using both GFP-based and LacZ-based Cre reporter strains, we demonstrate that in Ttr::Cre transgenics, Cre-mediated recombination occurs throughout the visceral endoderm PMID: 19415627
  45. he alleged neuroprotective role of TTR in the nervous system should be regarded with caution and should not be generalized to all types of insults PMID: 19595729
  46. rat and murine TTR have a lower intrinsic beta-aggregation propensity and a similar native beta-structure stability compared with human TTR. PMID: 19602727

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Transthyretin family
Tissue Specificity
Detected in plasma (at protein level). Detected in liver.
Database Links
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*