Recombinant Human Smoothened homolog(SMO)

Code CSB-CF857876HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q99835
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence RGAASSGNATGPGPRSAGGSARRSAAVTGPPPPLSHCGRAAPCEPLRYNVCLGSVLPYGA TSTLLAGDSDSQEEAHGKLVLWSGLRNAPRCWAVIQPLLCAVYMPKCENDRVELPSRTLC QATRGPCAIVERERGWPDFLRCTPDRFPEGCTNEVQNIKFNSSGQCEVPLVRTDNPKSWY EDVEGCGIQCQNPLFTEAEHQDMHSYIAAFGAVTGLCTLFTLATFVADWRNSNRYPAVIL FYVNACFFVGSIGWLAQFMDGARREIVCRADGTMRLGEPTSNETLSCVIIFVIVYYALMA GVVWFVVLTYAWHTSFKALGTTYQPLSGKTSYFHLLTWSLPFVLTVAILAVAQVDGDSVS GICFVGYKNYRYRAGFVLAPIGLVLIVGGYFLIRGVMTLFSIKSNHPGLLSEKAASKINE TMLRLGIFGFLAFGFVLITFSCHFYDFFNQAEWERSFRDYVLCQANVTIGLPTKQPIPDC EIKNRPSLLVEKINLFAMFGTGIAMSTWVWTKATLLIWRRTWCRLTGQSDDEPKRIKKSK MIAKAFSKRHELLQNPGQELSFSMHTVSHDGPVAGLAFDLNEPSADVSSAWAQHVTKMVA RRGAILPQDISVTPVATPVPPEEQANLWLVEAEISPELQKRLGRKKKRRKRKKEVCPLAP PPELHPPAPAPSTIPRLPQLPRQKCLVAAGAWGAGDSCRQGAWTLVSNPFCPEPSPPQDP FLPSAPAPVAWAHGRRQGLGPIHSRTNLMDTELMDADSDF
Source in vitro E.coli expression system
Gene Names SMO
Protein Names Recommended name: Smoothened homolog Short name= SMO Alternative name(s): Protein Gx
Expression Region 28-787
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function G protein-coupled receptor that probably associates with the patched protein (PTCH) to transduce the hedgehog's proteins signal. Binding of sonic hedgehog (SHH) to its receptor patched is thought to prevent normal inhibition by patched of smoothened (SMO). Required for the accumulation of KIF7, GLI2 and GLI3 in the cilia
Involvement in disease Curry-Jones syndrome (CRJS)
Subcellular Location Membrane, Multi-pass membrane protein, Cell projection, cilium
Protein Families G-protein coupled receptor Fz/Smo family
Database Links

HGNC: 11119

OMIM: 601500

KEGG: hsa:6608

STRING: 9606.ENSP00000249373

UniGene: Hs.437846

Pathway Hedgehog signaling pathway

Related Products

SMO Antibodies

SMO Antibodies for Homo sapiens (Human)

SMO Antibodies for Human

SMO Proteins

SMO Proteins for Homo sapiens (Human)

SMO ELISA Kit

SMO ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.