Recombinant Human Smoothened homolog (SMO)

Code CSB-CF857876HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
SMO; SMOH; Smoothened homolog; SMO; Protein Gx
Species
Homo sapiens (Human)
Expression Region
28-787
Target Protein Sequence
RGAASSGNATGPGPRSAGGSARRSAAVTGPPPPLSHCGRAAPCEPLRYNVCLGSVLPYGA TSTLLAGDSDSQEEAHGKLVLWSGLRNAPRCWAVIQPLLCAVYMPKCENDRVELPSRTLC QATRGPCAIVERERGWPDFLRCTPDRFPEGCTNEVQNIKFNSSGQCEVPLVRTDNPKSWY EDVEGCGIQCQNPLFTEAEHQDMHSYIAAFGAVTGLCTLFTLATFVADWRNSNRYPAVIL FYVNACFFVGSIGWLAQFMDGARREIVCRADGTMRLGEPTSNETLSCVIIFVIVYYALMA GVVWFVVLTYAWHTSFKALGTTYQPLSGKTSYFHLLTWSLPFVLTVAILAVAQVDGDSVS GICFVGYKNYRYRAGFVLAPIGLVLIVGGYFLIRGVMTLFSIKSNHPGLLSEKAASKINE TMLRLGIFGFLAFGFVLITFSCHFYDFFNQAEWERSFRDYVLCQANVTIGLPTKQPIPDC EIKNRPSLLVEKINLFAMFGTGIAMSTWVWTKATLLIWRRTWCRLTGQSDDEPKRIKKSK MIAKAFSKRHELLQNPGQELSFSMHTVSHDGPVAGLAFDLNEPSADVSSAWAQHVTKMVA RRGAILPQDISVTPVATPVPPEEQANLWLVEAEISPELQKRLGRKKKRRKRKKEVCPLAP PPELHPPAPAPSTIPRLPQLPRQKCLVAAGAWGAGDSCRQGAWTLVSNPFCPEPSPPQDP FLPSAPAPVAWAHGRRQGLGPIHSRTNLMDTELMDADSDF
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
G protein-coupled receptor that probably associates with the patched protein (PTCH) to transduce the hedgehog's proteins signal. Binding of sonic hedgehog (SHH) to its receptor patched is thought to prevent normal inhibition by patched of smoothened (SMO). Required for the accumulation of KIF7, GLI2 and GLI3 in the cilia. Interacts with DLG5 at the ciliary base to induce the accumulation of KIF7 and GLI2 at the ciliary tip for GLI2 activation.
Gene References into Functions
  1. Study present the crystal structure of the multi-domain human SMO in complex with a specially designed seven-transmembrane helices domain (TMD) ligand, shedding light on interactions between the cysteine-rich domain and TMD. Combining the structures with biophysical characterization and computer modelling results, study propose a mechanistic model of SMO activation. PMID: 28513578
  2. Case Report: Happle-Tinschert Syndrome is caused by mosaic SMO mutations and represents a variant of Curry-Jones syndrome. PMID: 29335739
  3. cholesterol within the bilayer is sufficient for constitutive Smoothened activation. Cholesterol effects occur independently of the lipid-binding Smoothened extracellular domain, a region that is dispensable for Patched1-Smoothened coupling. PMID: 29229834
  4. A somatic mutation in SMO likely accounts for the structural malformations and predisposition to form bowel hamartomas and myofibromas. The mutation burden in the involved tissues likely accounts for the variable manifestations PMID: 28386950
  5. Dual MET and SMO Inhibitors are potent antiproliferative agents in EGFR-Tyrosine kinase inhibitors resistant human non small cell lung cancer. PMID: 28787156
  6. Smoothened-antagonists reverse alterations in Hedgehog signaling and chondrocyte primary cilium length in homogentisic acid induced model of alkaptonuria. PMID: 28019670
  7. SMO mutation is associated with olfactory groove meningiomas. PMID: 28082415
  8. SMO is covalently modified by cholesterol. This modification is regulated by Ptch1 and Hh and is essential for Hh signaling. PMID: 28344083
  9. A screen for analogs revealed another six molecules, with IC50 values in the low micromolar range. Importantly, one of the most active of the new antagonists continued to be efficacious at the D473H mutant of Smoothened, which confers clinical resistance to the antagonist vismodegib in cancer treatment. PMID: 27490099
  10. Our studies demonstrate an important role for smoothened and glioma-associated oncogene homology-1 in gastric cancer and suggest inhibition of hedgehog pathway as a novel and potent strategy to treat gastric cancer patients PMID: 28675107
  11. The results suggest that Shh signaling plays an important role in rheumatoid arthritis-Fibroblast-like synoviocytes proliferation in a Smo-dependent manner. PMID: 26189371
  12. Mutations in SMO gene is associated with Curry-Jones Syndrome. PMID: 27236920
  13. The Hedgehog pathway receptor SMO is an important regulator of gastric cancer paclitaxel resistance. PMID: 28350784
  14. Role of SMO-mediated Hedgehog signaling pathway in the proliferation and apoptosis of multiple myeloma cells PMID: 27959416
  15. exogenous addition of 3beta,5alpha-dihydroxycholest-7-en-6-one, a naturally occurring B-ring oxysterol derived from 7-DHC that also accumulates in Smith-Lemli-Opitz syndrome, blocked Hedgehog signaling by inhibiting activation of the essential transduction component Smoothened, through a mechanism distinct from Smoothened modulation by other lipids. PMID: 27162362
  16. High SMO expression is associated with pancreatic and skin cancers. PMID: 26784250
  17. crystal structures of the Hh signal transducer and oncoprotein Smoothened, a GPCR that contains two distinct ligand-binding sites: one in its transmembrane domain and one in the cysteine-rich domain PMID: 27437577
  18. Smoothened determines beta-arrestin-mediated removal of the G protein-coupled receptor Gpr161 from the primary cilium. PMID: 27002170
  19. The combined inhibition of SMO and EGFR exerted a strong antiproliferative activity. PMID: 26124204
  20. Suggest that hypoxia promotes SMO transcription through upregulation of MAML3 and RBPJ to induce proliferation, invasiveness and tumorigenesis in pancreatic cancer. PMID: 26655998
  21. These findings suggest that miR-218 inhibits multidrug resistance of gastric cancer cells by down-regulating smoothened expression. PMID: 26261515
  22. Recipient SMO rs3824 polymorphism is associated with an increased risk of hepatocellular carcinoma recurrence following orthotopic liver transplantation. PMID: 25944162
  23. Strikingly, in basal cell carcinoma patients treated with Smo inhibitor, squamous cell cancers with RAS/MAPK activation emerged from the antecedent basal cell carcinoma tumors. PMID: 26130651
  24. report discussed two different SMO mutations representing examples of primary or secondary resistance respectively to vismodegib in two distinct basal cell carcinoma cases PMID: 25306392
  25. The SMOF412E mutation was not detected in ameloblastoma. The BRAFV600E-activating mutation is a common event in ameloblastomas, occurring regardless of site or histological type. This mutation is also detected in odontogenic carcinomas. PMID: 25854168
  26. SMO was upregulated in gliomas and was associated with tumor grade and survival period. SMO inhibition suppressed the biological behaviors of glioma cells. SMO expression was inversely correlated with miR-326 and is a novel direct target of miR-326. PMID: 25173582
  27. SMO expression was significantly associated with better colorectal cancer-specific survival. PMID: 25023548
  28. The Smoothened receptor (SMO) mediates signal transduction in the hedgehog pathway, which is implicated in normal development and carcinogenesis. PMID: 25008467
  29. analysis of small-molecule regulation of SMO and discussion of potential mechanisms for its endogenous regulation [review] PMID: 25785427
  30. SMO mutations are implicated in drug resistance in basal cell carcinoma. PMID: 25759019
  31. Mutations within the SMO protein are implicated in drug resistance in basal cell carcinoma. PMID: 25759020
  32. Studies indicate that Smoothened (Smo) inhibitor was beneficial for the treatment of advanced basal cell carcinoma (BCC). PMID: 24469022
  33. signaling mediated by Smo contributes to acquired chemoresistance through activating the transcriptional factor Gli PMID: 24393163
  34. SMO mutation is asociated with ameloblastoma. PMID: 24859340
  35. MicroRNA-338-3p could inhibit colorectal carcinoma cell invasion and migration by inhibiting smoothened expression. PMID: 24277750
  36. The structure of the Smo receptor will promote the development of small molecules interacting with a key therapeutic target with interests in regenerative medicine and cancer.[review] PMID: 24148123
  37. miR-338-3p could suppress colorectal carcinoma growth by inhibiting SMO protein expression. PMID: 23599646
  38. We observed strong correlation between higher SMO and SHH expression levels with poorer overall survival. PMID: 23379358
  39. Smo antagonism led to reduced Hedgehog pathway activity, resulting in decreased cell proliferation and induction of apoptosis via the intrinsic pathway in the esophageal cancer cells PMID: 23915072
  40. GSA-10 allows the pharmacological characterization of a novel Smo active site. PMID: 23448715
  41. downregulation of miR-326 may be a possible mechanism for unrestricted activation of Smo signal transducer of the oncogenic Hedgehog pathway in chronic myeloid leukemia PMID: 23341351
  42. Nonclassical activation of Hedgehog signaling enhances multidrug resistance and makes cancer cells refractory to Smoothened-targeting Hedgehog inhibition PMID: 23508962
  43. crystal structure of the transmembrane domain of the human SMO receptor bound to the small-molecule antagonist LY2940680 at 2.5 A resolution PMID: 23636324
  44. A subset of meningiomas lacking NF2 alterations harbored recurrent oncogenic mutations in AKT1 (p.Glu17Lys) and SMO (p.Trp535Leu) and exhibited immunohistochemical evidence of activation of these pathways. PMID: 23334667
  45. High SMO expression is asociated with postoperative liver metastasis in colon cancer. PMID: 23098507
  46. SMO mutations, which activate Hedgehog signaling, were identified in ~5% of non-NF2 mutant meningiomas PMID: 23348505
  47. High SMO expression is associated with colorectal cancer. PMID: 22901214
  48. Study shows that hedgehog signaling rewires cellular metabolism; Smo-dependent noncanonical signal rewires metabolism in vitro and in vivo. PMID: 23063129
  49. different pools of Smo move into cilia through distinct mechanisms PMID: 22864913
  50. the effects of oxysterols on Hedgehog signaling are exquisitely stereoselective, consistent with the hypothesis that they function through a specific protein target. PMID: 22231273

Show More

Hide All

Involvement in disease
Curry-Jones syndrome (CRJS)
Subcellular Location
Membrane; Multi-pass membrane protein. Cell projection, cilium.
Protein Families
G-protein coupled receptor Fz/Smo family
Database Links

HGNC: 11119

OMIM: 601500

KEGG: hsa:6608

STRING: 9606.ENSP00000249373

UniGene: Hs.437846

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1