Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
E ras; E-Ras; ecat5; Embryonic stem cell expressed Ras ; Embryonic stem cell-expressed Ras; Eras; ES cell expressed Ras; GTPase ERas; Ha-Ras2; HRAS2; HRASP; MGC126691; MGC126693; OTTHUMP00000065857 ; RASE_HUMAN; Small GTPase protein E Ras; v Ha ras Harvey rat sarcoma viral oncogene homolog pseudogene ; v Ha ras Harvey rat sarcoma viral oncogene homolog 2
Species
Homo sapiens (Human)
Expression Region
3-230aa
Target Protein Sequence
LPTKPGTFDLGLATWSPSFQGETHRAQARRRDVGRQLPEYKAVVVGASGVGKSALTIQLNHQCFVEDHDPTIQDSYWKELTLDSGDCILNVLDTAGQAIHRALRDQCLAVCDGVLGVFALDDPSSLIQLQQIWATWGPHPAQPLVLVGNKCDLVTTAGDAHAAAAALAHSWGAHFVETSAKTRQGVEEAFSLLVHEIQRVQEAMAKEPMARSCREKTRHQKATCHCGC
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The production of this Recombinant Human ERAS protein started with the ERAS gene synthesis. And then using recombinant DNA technology, the ERAS gene was inserted into an expression vector so that we could get the recombinant express plasmid of ERAS. Transform the plasmid into the cells of E.coli, culture the cells and we could get the desired Recombinant Human ERAS protein. But the work was not completed, protein purification and a strict QC system were performed in the last step. The purity is 90%+ determined by SDS-PAGE.
ERAS (also named HRAS2 or HRASP) is a gene providing an instruction of making a protein named GTPase ERas (ERas) in human. The protein encoded by this gene is also known as Embryonic stem cell-expressed Ras and belongs to Ras family found in murine embryonic stem (ES) cells in 2003. Increasing studies has been reported that ERAS may provide resistance to chemotherapy in different human tumorigenic cells through activation of the PI3K/AKT/mTOR pathway, promoting both DNA replication and transcription.
