Recombinant Human GTPase ERas (ERAS), partial

Code CSB-EP801806HU1
Abbreviation Recombinant Human ERAS protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
ERAS
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
E ras; E-Ras; ecat5; Embryonic stem cell expressed Ras ; Embryonic stem cell-expressed Ras; Eras; ES cell expressed Ras; GTPase ERas; Ha-Ras2; HRAS2; HRASP; MGC126691; MGC126693; OTTHUMP00000065857 ; RASE_HUMAN; Small GTPase protein E Ras; v Ha ras Harvey rat sarcoma viral oncogene homolog pseudogene ; v Ha ras Harvey rat sarcoma viral oncogene homolog 2
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
3-230aa
Target Protein Sequence
LPTKPGTFDLGLATWSPSFQGETHRAQARRRDVGRQLPEYKAVVVGASGVGKSALTIQLNHQCFVEDHDPTIQDSYWKELTLDSGDCILNVLDTAGQAIHRALRDQCLAVCDGVLGVFALDDPSSLIQLQQIWATWGPHPAQPLVLVGNKCDLVTTAGDAHAAAAALAHSWGAHFVETSAKTRQGVEEAFSLLVHEIQRVQEAMAKEPMARSCREKTRHQKATCHCGC
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
28.8kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The production of this Recombinant Human ERAS protein started with the ERAS gene synthesis. And then using recombinant DNA technology, the ERAS gene was inserted into an expression vector so that we could get the recombinant express plasmid of ERAS. Transform the plasmid into the cells of E.coli, culture the cells and we could get the desired Recombinant Human ERAS protein. But the work was not completed, protein purification and a strict QC system were performed in the last step. The purity is 90%+ determined by SDS-PAGE.

ERAS (also named HRAS2 or HRASP) is a gene providing an instruction of making a protein named GTPase ERas (ERas) in human. The protein encoded by this gene is also known as Embryonic stem cell-expressed Ras and belongs to Ras family found in murine embryonic stem (ES) cells in 2003. Increasing studies has been reported that ERAS may provide resistance to chemotherapy in different human tumorigenic cells through activation of the PI3K/AKT/mTOR pathway, promoting both DNA replication and transcription.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. Plays an important role in the tumor-like growth properties of embryonic stem cells.
Gene References into Functions
  1. N-terminal extension of E-RAS is important for E-RAS signaling activity. PMID: 25940089
  2. Expression of ERAS in human melanoma cell lines conferred resistance to PLX4720 and induced hyperphosphorylation of AKT. PMID: 25624498
  3. After knocking down the ERas gene by siRNA, we observed that there was a significant decrease in proliferation, metastasis as well as clonality in gastric carcinoma. PMID: 23612786
  4. Data indicate that expression of ERAS, LHX1, and CCRK is increased in aggressive subgroups of medulloblastomas. PMID: 22875024
  5. ERas may be a potential biomarker for gastric cancer, but advanced studies are wanted. PMID: 21151392
  6. These data suggest that ERas is activated in a significant population of gastric cancer, where it may play a crucial role in gastric cancer cell survival and metastases to liver via down-regulation of E-cadherin. PMID: 20566745
  7. ERas/PI3K pathway may provide resistance to chemotherapy and promote transforming activity in neuroblastoma. PMID: 20811723
  8. transforming oncogene ERas is important in the tumour-like growth properties of embryonic stem cells PMID: 12774123
  9. Studies on ERas gene expression. PMID: 16081664
  10. rasH2 may have a role in susceptibility to chemically-induced tongue and esophageal neoplasms PMID: 18174262
  11. High ERas is associated with the tumorigenic process of gastric carcinomas. PMID: 19528480
  12. Loss of methylation in the promoter of ERas might be one of mechanisms responsible for the re-expression of an embryonic oncogene in gastric cancer. PMID: 19787253

Show More

Hide All

Subcellular Location
Cell membrane; Lipid-anchor; Cytoplasmic side.
Protein Families
Small GTPase superfamily, Ras family
Database Links

HGNC: 5174

OMIM: 300437

KEGG: hsa:3266

STRING: 9606.ENSP00000339136

UniGene: Hs.447330

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*