Code | CSB-YP009306HU |
Abbreviation | Recombinant Human GC protein, partial |
MSDS | |
Size | $276 |
Order now | |
Image |
|
Have Questions? | Leave a Message or Start an on-line Chat |
The process of expressing the recombinant human GC protein in the yeast requires the recombinant DNA gene formed by the integration of encoding gene for the 19-474aa of the human GC protein and N-terminal 6xHis-SUMOSTAR tag sequence, the expression vector that the recombinant DNA gene inserts into, the yeast that provided the necessary macromolecules and components for transcription and translation of the cloned expression vector. After isolation and purification, this N-terminal 6xHis-SUMOSTAR-tagged recombinant GC protein was obtained. This recombinant GC protein is characterized by high purity (>90%, SDS-PAGE). This GC protein ran along the gel to the band of approximately 52 kDa molecular weight.
GC is a gene providing instruction of making a protein named Vitamin D-binding protein (also abbreviated as VDB or DBP) in human and belongs to ALB/AFP/VDB family. DBP is a multifunctional protein that is well-conserved in the evolution of vertebrates. This protein plays a crtical role in vitamin D metabolites. In addtion to transporting vitamin D metabolites, DBP is proposed to be involved in the transport of fatty acids, in complement C5a-mediated chemotaxis, and in the activation of macrophages.
There are currently no reviews for this product.
Could you quote the following product?
1. Is 10ug the minimum quantity?
2. What is the shelf life of both liquid form and powder form?
RGRDYEKNKVCKEFSHLGKEDFTSLSLVLYSRKFPSGTFEQVSQLVKEVVSLTEACCAEGADPDCYDTRTSALSAKSCESNSPFPVHPGTAECCTKEGLERKLCMAALKHQPQEFPTYVEPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLLVSYTKSYLSMVGSCCTSASPTVCFLKERLQLKHLSLLTTLSNRVCSQYAAYGEKKSRLSNLIKLAQKVPTADLEDVLPLAEDITNILSKCCESASEDCMAKELPEHTVKLCDNLSTKNSKFEDCCQEKTAMDVFVCTYFMPAAQLPELPDVELPTNKDVCDPGNTKVMDKYTFELSRRTHLPEVFLSKVLEPTLKSLGECCDVEDSTTCFNAKGPLLKKELSSFIDKGQELCADYSENTFTEYKKKLAERLKAKLPDATPKELAKLVNKRSDFASNCCSINSPPLYCDSEIDAELKNIL
I am interested in the Recombinant Human Vitamin D-binding protein(GC) product that you manufacture and would very much appreciate if you would answer all my questions.
1. First and most importantly, is this protein registered with the FDA as a food source, or a pharmaceutical?
2. Are there any license/credentials required to be able to obtain this product from you?
3. Could you tell me how other companies are using the protein?
4. What are your recommended uses for this ingredient?
5. Are there any ingredients that if you were to add your protein to it, that would render the protein unsafe, or cause the protein to lose its potency?
6.What would be the best stabilizing ingredients to go along with the protein?
7. Which of the two kinds that you sell would perform the best and have the longest shelf-life?
8. when/why would you choose the liquid over the freeze-dried version?
9. Are there any restrictions adding it to a cream base that you know of?
10. Any applications you don't advise using it in or for?
11. What are the best fats to combine with the protein for it to be the most effective it can be?
12. When you mention "buffer" I'm assuming you're talking about buffering the protein with other ingredients, in a cream/gel etc.?
13. What is the cost of the protein and in what sizes do you sell them?
14. what is the recommended usage rate of both your products?
We are hoping to get the same lot as a previous order you sent to us: Lot# 03103. Do you know if there has been any change between the expression processes back in 2016 for Lot# 03103, and the current lot that is being expressed?
We are interested in purchasing 2mg of the Yeast-expressed protein, with Endotoxin Removal + Aseptic Processing. Would it be possible to get 2mg of the same protein as lot# 03103, with endotoxin removal and aseptic processing? If so, can you please provide pricing for this quantity?
I ordered this protein last time and I'm very happy with the protein.
I'd like to check if you have this protein in stock now ? I should be able to send an order to you very soon.