Recombinant Staphylococcus aureus Zinc metalloproteinase aureolysin (aur)

In Stock
Code CSB-EP305800FKZ
Abbreviation Recombinant Staphylococcus aureus aur protein
MSDS
Size US$388
Order now
Image
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP305800FKZ could indicate that this peptide derived from E.coli-expressed Staphylococcus aureus aur.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP305800FKZ could indicate that this peptide derived from E.coli-expressed Staphylococcus aureus aur.
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
aur
Uniprot No.
Research Area
Cell Biology
Alternative Names
aur; Zinc metalloproteinase aureolysin; EC 3.4.24.29; Staphylococcus aureus neutral proteinase
Species
Staphylococcus aureus
Source
E.coli
Expression Region
210-509aa
Target Protein Sequence
AATGTGKGVLGDTKDININSIDGGFSLEDLTHQGKLSAYNFNDQTGQATLITNEDENFVKDDQRAGVDANYYAKQTYDYYKNTFGRESYDNHGSPIVSLTHVNHYGGQDNRNNAAWIGDKMIYGDGDGRTFTNLSGANDVVAHELTHGVTQETANLEYKDQSGALNESFSDVFGYFVDDEDFLMGEDVYTPGKEGDALRSMSNPEQFGQPSHMKDYVYTEKDNGGVHTNSGIPNKAAYNVIQAIGKSKSEQIYYRALTEYLTSNSNFKDCKDALYQAAKDLYDEQTAEQVYEAWNEVGVE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
40.2 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Constructing a plasmid that codes for the Staphylococcus aureus aur protein (210-509aa) initiates the generation of the recombinant Staphylococcus aureus aur protein. The constructed plasmid is transformed into 210-509aa cells. Positive e.coli cells are selected and then cultured under conditions that encourage the expression of the gene of interest. The protein is equipped with a N-terminal 10xHis tag and C-terminal Myc tag. After that, affinity purification is employed to isolate and purify the recombinant aur protein from the cell lysate. The purity of the resulting recombinant aur protein is over 85%, determined by SDS-PAGE.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

I am looking for this enzyme: metalloproteinase aureolysin (aur) Recombinant Protein
If available, I would like to know the following details:
- Which tag has the protein?
- Is the enzyme active?

A:
Thanks for your inquiry. Recombinant Staphylococcus aureus Zinc metalloproteinase aureolysin(aur)
CSB-YP305800FKZ Yeast; Tag information: N-terminal 6xHis-tagged
CSB-EP305800FKZ E.coli; Tag information: N-terminal 10xHis-tagged and C-terminal Myc-tagged
CSB-BP305800FKZ Baculovirus; Tag information: N-terminal 10xHis-tagged and C-terminal Myc-tagged
CSB-MP305800FKZ Mammalian cell; Tag information: The tag will be determined in the production process.
Expression region: 210-509aa, full length of mature protein;
Target protein sequence:

AATGTGKGVLGDTKDININSIDGGFSLEDLTHQGKLSAYNFNDQTGQATLITNEDENFVKDDQRAGVDANYYAKQTYDYYKNTFGRESYDNHGSPIVSLTHVNHYGGQDNRNNAAWIGDKMIYGDGDGRTFTNLSGANDVVAHELTHGVTQETANLEYKDQSGALNESFSDVFGYFVDDEDFLMGEDVYTPGKEGDALRSMSNPEQFGQPSHMKDYVYTEKDNGGVHTNSGIPNKAAYNVIQAIGKSKSEQIYYRALTEYLTSNSNFKDCKDALYQAAKDLYDEQTAEQVYEAWNEVGVE


We didn't test the activity of this protein. As we provide the full length of mature protein, it is active in theory. But can not 100% guaranteed.

Target Background

Function
Plays an essential role in immune evasion by helping bacteria to resist complement-mediated killing by neutrophils. Inhibits the deposition of host C3b on bacterial surfaces and the release of the chemoattractant C5a by cleaving the central complement protein C3. The cleavage site renders the C3b molecule vulnerable to proteolytic degradation by host regulators. Cleaves and inactivates host SERPINA1, which is an endogenous protease inhibitor essential for controlling neutrophil serine protease elastase. Plays also an essential role in the cleavage and subsequent activation of the serine protease SspA which is involved in colonization and infection of human tissues.
Protein Families
Peptidase M4 family
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*