Code | CSB-EP305800FKZ |
Abbreviation | Recombinant Staphylococcus aureus aur protein |
MSDS | |
Size | US$388 |
Order now | |
Image |
|
Have Questions? | Leave a Message or Start an on-line Chat |
Constructing a plasmid that codes for the Staphylococcus aureus aur protein (210-509aa) initiates the generation of the recombinant Staphylococcus aureus aur protein. The constructed plasmid is transformed into 210-509aa cells. Positive e.coli cells are selected and then cultured under conditions that encourage the expression of the gene of interest. The protein is equipped with a N-terminal 10xHis tag and C-terminal Myc tag. After that, affinity purification is employed to isolate and purify the recombinant aur protein from the cell lysate. The purity of the resulting recombinant aur protein is over 85%, determined by SDS-PAGE.
There are currently no reviews for this product.
I am looking for this enzyme: metalloproteinase aureolysin (aur) Recombinant Protein
If available, I would like to know the following details:
- Which tag has the protein?
- Is the enzyme active?
AATGTGKGVLGDTKDININSIDGGFSLEDLTHQGKLSAYNFNDQTGQATLITNEDENFVKDDQRAGVDANYYAKQTYDYYKNTFGRESYDNHGSPIVSLTHVNHYGGQDNRNNAAWIGDKMIYGDGDGRTFTNLSGANDVVAHELTHGVTQETANLEYKDQSGALNESFSDVFGYFVDDEDFLMGEDVYTPGKEGDALRSMSNPEQFGQPSHMKDYVYTEKDNGGVHTNSGIPNKAAYNVIQAIGKSKSEQIYYRALTEYLTSNSNFKDCKDALYQAAKDLYDEQTAEQVYEAWNEVGVE