Recombinant Human Tumor necrosis factor receptor superfamily member 6 (FAS)

Code CSB-CF008433HU(A4)
MSDS
Size $1620
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cell Biology
Alternative Names
FAS; APT1; FAS1; TNFRSF6; Tumor necrosis factor receptor superfamily member 6; Apo-1 antigen; Apoptosis-mediating surface antigen FAS; FASLG receptor; CD antigen CD95
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
26-335aa
Target Protein Sequence
QVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSNLGWLCLLLLPIPLIVWVKRKEVQKTCRKHRKENQGSHESPTLNPETVAINLSDVDLSKYITTIAGVMTLSQVKGFVRKNGVNEAKIDEIKNDNVQDTAEQKVQLLRNWHQLHGKKEAYDTLIKDLKKANLCTLAEKIQTIILKDITSDSENSNFRNEIQSLV
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
40.6 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant Human FAS protein is a cell-free system in vitro E.coli expressed protein (Full Length of Mature Protein). In cell-free systems, synthesis of the protein can be carried out in vitro using extracts of whole cells that are compatible with translation. These cell extracts contain all the molecules and enzymes that are needed to transcribe, translate, and post-translationally modify the recombinant protein. With additional supplements of cofactors, FAS proteins can be formed in a few hours. However, this system may not be applicable for the large-scale production of recombinant proteins. Advantages of this system include that proteins can be synthesized without cell culturing; also, it is possible to express many proteins together.

FAS, also known as APO-1/CD95/TNFRSF6, is abundantly expressed in the thymus, liver, heart, and kidney. FAS-FASL interactions result in the formation of a death-inducing signaling complex (DISC) in the FAS-expressing cells, inducing apoptosis. Mutations in FAS receptors are linked to a loss of apoptotic signaling and have been found in an autoimmune disorder autoimmune lymphoproliferative syndrome (ALPS) type Ia. Furthermore, FAS is considered a tumor suppressor because deletions and mutations of FAS have been reported in many cancers. FAS engagement has recently been shown to elicit nonapoptotic signals that promote inflammation and carcinogenesis.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

Regarding your protein CSB-CF008433HU, could you please provide some informations?
Also, have you had any customers order this protein before? If so, could you please advise on the purity obtained? Would you be able to provide a representative COA?

A:
Very nice to receive your inquiry. This is a transmembrane protein that we can only provide the full length protein with cell free expression system and provide the partial protein with four regular expression systems, such as E.coli, Yeast, Baculovirus and Mammalian cell.
Recombinant Human Tumor necrosis factor receptor superfamily member 6(FAS)
CSB-CF008433HU(A4)
Expression Region: 26-335aa; Full length of the mature protein.
Tag information:Tag type will be determined during the manufacturing process. (The expected tag is N-terminal 10xHis-tagged)
Sequence:

QVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSNLGWLCLLLLPIPLIVWVKRKEVQKTCRKHRKENQGSHESPTLNPETVAINLSDVDLSKYITTIAGVMTLSQVKGFVRKNGVNEAKIDEIKNDNVQDTAEQKVQLLRNWHQLHGKKEAYDTLIKDLKKANLCTLAEKIQTIILKDITSDSENSNFRNEIQSLV


In addition, below are the information about the partial protein expressed by the four regular expression systems:
Recombinant Human Tumor necrosis factor receptor superfamily member 6(FAS),partial
CSB-YP008433HU >> Yeast
CSB-EP008433HU >> E.coli
CSB-BP008433HU >> Baculovirus
CSB-MP008433HU >> Mammalian cell
Expression Region: 26-171aa; Partial.
Tag information:EP, YP, BP, MP: Tag type will be determined during the manufacturing process.
The expected tag for each expression system is listed as follows:
YP: N-terminal 6xHis-tagged; EP, BP, MP: N-terminal 10xHis-tagged and C-terminal Myc-tagged.
Sequence:

QVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSR


Sorry, all of them are semi-custom proteins that we haven't expressed before, so no customer ordered and the COA is not available for the time being.
We can guarantee that the final purity will be more than 85%, if you have higher requirement for the purity, please also communicate with us in advance, we can try as high purity as possible, but we just can't 100% guarantee the purity shown on the COA can reach 90% or 95%.

Target Background

Function
Receptor for TNFSF6/FASLG. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. FAS-mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both. The secreted isoforms 2 to 6 block apoptosis (in vitro).
Gene References into Functions
  1. that FAS death domain or TP53 DNA-binding domain mutations, down-regulation of FAS receptor expression PMID: 30278467
  2. CD95-mediated apoptosis induces Pim-1 down-regulation in Burkitt's lymphoma (BL) B-cells, but Pim-1 down-regulation cannot fully eradicate BL and leukaemia. PMID: 27641442
  3. Fas single-nucleotide polymorphisms rs2234767 and rs1800682 are involved in the pathogenesis of Idiopathic Aplastic Anemia PMID: 29611722
  4. The mRNA expression of FAS was lower in patients with TP53 mutation than TP53 wild-type. Our findings suggest that TP53 mutation is a potential negative predictor of metastatic melanoma treated with CTLA-4 blockade. PMID: 29793878
  5. Complete local landscape for a defined molecular function-the alternative splicing of an exon (FAS/CD95 exon 6). The extensive epistasis in the landscape predicts that exonic regulatory sequences may diverge between species even when exon inclusion levels are functionally important and conserved by selection. PMID: 27161764
  6. Paper analyses results of serum cytokines and lymphocyte apoptosis study in nodular goiter against the background of autoimmune thyroiditis and thyroid adenoma based on the cell preparedness to apoptosis, the number of apoptotic lymphocytes and the content of proapoptotic tumor necrosis factor-alpha, interleukins in serum, considering the polymorphism of BCL-2, CTLA-4 and APO-1 genes. PMID: 29250672
  7. These results demonstrated that overexpression of ING4 can induce the apoptosis of melanoma cells and CD3+ T cells through signaling pathways such as the Fas/FasL pathway, and that ING4 gene therapy for melanoma treatment is a novel approach. PMID: 29207034
  8. Tag7 activates lymphocytes capable of Fasl-Fas-dependent contact killing of virus-infected cells. PMID: 29083508
  9. These results indicated that cMyc and Fas regulated the sensitivity of A549 cells to irradiation by regulating caspase8-mediated Bid activation and the subsequent association with the mitochondrial pathway of apoptosis. PMID: 28849062
  10. this study characterized in juvenile systemic lupus erythematosus a distinct profile from adult SLE that comprises increased sFas, sTRAIL, and reduced sFasL, notably in patients with active disease and with nephritis. PMID: 28378099
  11. results from the current study showed that the association of FAS-670A/G SNP with idiopathic azoospermia was not found in a population of men with idiopathic infertility. PMID: 28942044
  12. The Btk-dependent PIP5K1gamma lipid kinase activation by Fas counteracts FasL-induced cell death. PMID: 28879546
  13. Study identify genes highly expressed in Kras knockout lung cancer cells, including the Fas receptor gene. Antibodies that activate Fas receptor selectively induced apoptosis in Kras-independent lung cancer cells suggesting that FAS is involved in KRAS-related drug resistance. PMID: 28320962
  14. The authors observed differential expression of CD95(Fas) in CD27(+) B-cells from cirrhotic patients that was inversely correlated with peripheral CD27(+) B-cell frequency. They conclude that peripheral CD27(+) memory B-cells in cirrhosis exhibit increased sensitivity to Fas-induced apoptosis in an activation-dependent manner to which endotoxin contributes, associated with reduced frequency of circulating memory B-cells. PMID: 27857173
  15. the analysis of mRNA level showed that disease progression is associated with significantly increased expression of FasR and/or FasL. In conclusion, our observation seems to confirm that spherical model of cancer lines is more reliable for some sophisticated analysis because of their greater resemblance to the CSCs from human CRC samples in comparison to commonly used adherent cells PMID: 28766682
  16. study indicates FAS-FASL promoter SNPs may promote the production of cross-reactive anti-ganglioside antibodies in GBS PMID: 29432441
  17. In primary hyperparathyroidism, hyperplasias demonstrated the highest expression of TRAIL and Fas, whereas in adenomas it was increased compared to normal tissue, but lower than in hyperplasias. PMID: 27763797
  18. Data suggest that Fas and TNFR1 are involved in glaucoma mechanisms in cornea; pro-apoptotic effect of anti-glaucoma medication clonidine on corneal epithelial cells triggers Fas/TNFR1-mediated, mitochondria-dependent signaling pathway. (Fas = Fas cell surface death receptor ; TNFR1 = TNF receptor superfamily member 1A) PMID: 28115640
  19. These data suggested that YY1 may be important for apoptosis induction via the regulation of Fas during sepsis. Therefore, Fas may be a potential therapeutic target to prevent MOD through regulation of YY1 expression. Furthermore, YY1 and Fas expression in PBMCs may be used to as prognostic markers. PMID: 28447715
  20. Fas activation rapidly changes the interconversion of PC and PI, which then drives enhanced endocytosis, thus likely propagating death signaling from the cell surface to mitochondria and other organelles PMID: 28299505
  21. using pifithrin alpha we observed a decrease in apoptosis induced by MG132, and by APO-1 plus MG132, suggesting that restoration of APO-1 sensitivity occurs in part through an increase in both the levels and the activity of p53. The use of small molecules to inhibit the proteasome pathway might permit the activation of cell death, providing new opportunities for CC treatment. PMID: 27766434
  22. Fas - 670A/G genotypes or alleles were not significantly different between controls and transplant recipients and among transplant recipients with and without acute rejection following pediatric renal transplantation PMID: 27109035
  23. data suggest miR-374a is a negative regulator of Fas death receptor which is able to enhance the cell survival and protect retinal pigment epithelial cells against oxidative conditions. PMID: 28543858
  24. CD3(+) CD8(+) NKG2D(+) T Lymphocytes Induce Apoptosis and Necroptosis in HLA-Negative Cells via FasL-Fas Interaction PMID: 28294381
  25. High-grade gliomas (HGG) showed significantly lower FAS but higher FAS ligand (FAS-L) expression than high-grade gliomas (HGG). PMID: 29187439
  26. Peripheral CD95 expression higher than 30% could be used among the exclusion criteria in a multicomponent score for mycosis fungoides diagnosis. PMID: 28206666
  27. anti-apoptotic molecules BclxL and Bcl-2 and the pro-apoptotic factors BAD and BID cooperate to promote migration of triple-negative breast cancer cells stimulated with cl-CD95L. PMID: 27367565
  28. Knockout (KO) or knockdown of caspase-8, CD95 or FADD prevents activation of Plk3 upon CD95 stimulation, suggesting a requirement of a functional death-inducing signaling complex for Plk3 activation. PMID: 27325299
  29. STAT1 is a key regulator of the cancer stem cell-inducing activity of CD95. PMID: 28273453
  30. Two unrelated patients with severe recessive autoimmune lymphoproliferative syndrome had rare splicing defects in exon 6 of FAS. PMID: 28668589
  31. CD95-induced senescence was caused by chronic DNA damage. PMID: 28300842
  32. CD95 maintains stem cell-like and non-classical epithelial-mesenchymal transition programs in primary human glioblastoma cells. PMID: 27124583
  33. Data (including data from studies using tissues from transgenic mice) suggest that IL1B plays dual roles by (1) mediating islet amyloid-induced FAS up-regulation and apoptosis in pancreatic beta-cells and (2) down-regulating IAPP precursor processing thereby potentiating islet amyloid formation. (IL1B = interleukin-1beta; FAS = FAS cell surface death receptor; IAPP = islet amyloid polypeptide) PMID: 28058779
  34. MACC1 regulates Fas mediated apoptosis through STAT1/3 - Mcl-1 signaling in solid cancers. PMID: 28649004
  35. no association between the FAS polymorphism (rs1800682) and the susceptibility to persistent precancerous lesions and cervical cancer. PMID: 27899077
  36. These findings suggest that rs1800682, rs2234767, and rs763110 genotypes are not associated with the presence of HTLV-1-associated myelopathy/tropical spastic paraparesis, but that the FAS-670 AA genotype can promote higher proviral load values in HTLV-1-associated myelopathy/tropical spastic paraparesis patients. PMID: 27603042
  37. findings showed the variant allele and genotype of the FAS c.-671A>G polymorphism were significantly associated with increased risk of cervical cancer in Malaysian population, particularly those of Malay ethnicity; however, results of meta-analysis showed a lack of association between the polymorphism and cervical cancer risk PMID: 28279307
  38. Fas cell surface death receptor (FAS) was identified as an independent prognostic marker for recurrence free survival in breast cancer, with large variation in expression by receptor subtypes. PMID: 28121628
  39. data also demonstrated that the CD154-triggered inhibition of the Fas-mediated cell death response was dependent on a suppression of caspase-8 cleavage, but independent of de novo protein synthesis or alterations in Fas expression on cell surface. PMID: 27391025
  40. We have identified two single nucleotide polymorphisms in two immune-related genes ( MBL" and CD95) that have an association with severe and potentially life-threatening infection following doxorubicin and cyclophosphamide therapy for breast cancer PMID: 27940354
  41. With rs7901656 on the FAS gene as a paradigm, we show how allele specific transcription factor complex assembly and disruption by a causal variant contributes to disease and phenotypic diversity PMID: 27616356
  42. Increased TIM3+CD8+T cells with lower perforin and granzyme B expression and higher CD95 expression in MDS patients were observed. PMID: 27846431
  43. FAS c.-671AG genotype is not to be a risk factor in familial mediterranean fever. PMID: 28442396
  44. functional inhibition of miR-29c caused resistance to Fas-mediated apoptosis in lung fibroblasts. PMID: 27765762
  45. Most of the plasma cells of a paient with a heterozygous germline FAS mutation were Fas-deficient suggesting that Fas signaling plays a role also in the selection of germinal center B cells into the pool of long-lived plasma cells, similar to switched memory B cells. PMID: 26907631
  46. a substantial subgroup of the ITP patients displayed a defective Fas function; most of them displayed decreased Fas expression in T cells activated in vitro. PMID: 27391055
  47. Fas gene polymorphism is associated with Hashimoto's thyroiditis. PMID: 27572459
  48. There is a positive correlation of the serum level of sFasL( Fas/FasL axis ) with uptake index of parotid gland in our expectation. In addition, liver injury involvement in SS patients showed decreased level of sFasL. Furthermore, we here also observed that the protective cytokine IL-10 expression was positively correlated with sFasL expression PMID: 28326325
  49. The Fas-1377G > A polymorphism is associated with a higher risk of pre-eclampsia. PMID: 27277758
  50. Fas rs2234767 G/A SNPs might be associated with an increased risk of rheumatoid arthritis. PMID: 26905515

Show More

Hide All

Involvement in disease
Autoimmune lymphoproliferative syndrome 1A (ALPS1A)
Subcellular Location
[Isoform 1]: Cell membrane; Single-pass type I membrane protein. Membrane raft.; [Isoform 2]: Secreted.; [Isoform 3]: Secreted.; [Isoform 4]: Secreted.; [Isoform 5]: Secreted.; [Isoform 6]: Secreted.
Tissue Specificity
Isoform 1 and isoform 6 are expressed at equal levels in resting peripheral blood mononuclear cells. After activation there is an increase in isoform 1 and decrease in the levels of isoform 6.
Database Links

HGNC: 11920

OMIM: 134637

KEGG: hsa:355

STRING: 9606.ENSP00000347979

UniGene: Hs.244139

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*