Code | CSB-CF008433HU(A4) |
Size | US$3401 |
Image | |
Have Questions? | Leave a Message or Start an on-line Chat |
Description |
The recombinant Human FAS protein is a cell-free system in vitro E.coli expressed protein (Full Length of Mature Protein). In cell-free systems, synthesis of the protein can be carried out in vitro using extracts of whole cells that are compatible with translation. These cell extracts contain all the molecules and enzymes that are needed to transcribe, translate, and post-translationally modify the recombinant protein. With additional supplements of cofactors, FAS proteins can be formed in a few hours. However, this system may not be applicable for the large-scale production of recombinant proteins. Advantages of this system include that proteins can be synthesized without cell culturing; also, it is possible to express many proteins together. FAS, also known as APO-1/CD95/TNFRSF6, is abundantly expressed in the thymus, liver, heart, and kidney. FAS-FASL interactions result in the formation of a death-inducing signaling complex (DISC) in the FAS-expressing cells, inducing apoptosis. Mutations in FAS receptors are linked to a loss of apoptotic signaling and have been found in an autoimmune disorder autoimmune lymphoproliferative syndrome (ALPS) type Ia. Furthermore, FAS is considered a tumor suppressor because deletions and mutations of FAS have been reported in many cancers. FAS engagement has recently been shown to elicit nonapoptotic signals that promote inflammation and carcinogenesis. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Target Names | FAS |
Uniprot No. | P25445 |
Research Area | Cell Biology |
Alternative Names | FAS; APT1; FAS1; TNFRSF6; Tumor necrosis factor receptor superfamily member 6; Apo-1 antigen; Apoptosis-mediating surface antigen FAS; FASLG receptor; CD antigen CD95 |
Species | Homo sapiens (Human) |
Source | in vitro E.coli expression system |
Expression Region | 26-335aa |
Target Protein Sequence | QVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSNLGWLCLLLLPIPLIVWVKRKEVQKTCRKHRKENQGSHESPTLNPETVAINLSDVDLSKYITTIAGVMTLSQVKGFVRKNGVNEAKIDEIKNDNVQDTAEQKVQLLRNWHQLHGKKEAYDTLIKDLKKANLCTLAEKIQTIILKDITSDSENSNFRNEIQSLV Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Mol. Weight | 40.6 kDa |
Protein Length | Full Length of Mature Protein |
Tag Info |
N-terminal 10xHis-tagged |
Form |
Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
Regarding your protein CSB-CF008433HU, could you please provide some informations?
Also, have you had any customers order this protein before? If so, could you please advise on the purity obtained? Would you be able to provide a representative COA?
QVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSNLGWLCLLLLPIPLIVWVKRKEVQKTCRKHRKENQGSHESPTLNPETVAINLSDVDLSKYITTIAGVMTLSQVKGFVRKNGVNEAKIDEIKNDNVQDTAEQKVQLLRNWHQLHGKKEAYDTLIKDLKKANLCTLAEKIQTIILKDITSDSENSNFRNEIQSLV
QVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSR
Function |
Receptor for TNFSF6/FASLG. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. FAS-mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both. The secreted isoforms 2 to 6 block apoptosis (in vitro).
|
Gene References into Functions |
|
Involvement in disease | Autoimmune lymphoproliferative syndrome 1A (ALPS1A) |
Subcellular Location | [Isoform 1]: Cell membrane; Single-pass type I membrane protein. Membrane raft.; [Isoform 2]: Secreted.; [Isoform 3]: Secreted.; [Isoform 4]: Secreted.; [Isoform 5]: Secreted.; [Isoform 6]: Secreted. |
Tissue Specificity | Isoform 1 and isoform 6 are expressed at equal levels in resting peripheral blood mononuclear cells. After activation there is an increase in isoform 1 and decrease in the levels of isoform 6. |
Database Links |
HGNC: 11920 OMIM: 134637 KEGG: hsa:355 STRING: 9606.ENSP00000347979 UniGene: Hs.244139 |