Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-CF008433HU(A4) |
| Product Type | Transmembrane Protein |
| Size | Pls inquiry other sizes |
| Uniprot No. | P25445 |
| Image |
|
| Storage Buffer | Tris-based buffer，50% glycerol |
| Species | Homo sapiens (Human) |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Sequence | QVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSNLGWLCLLLLPIPLIVWVKRKEVQKTCRKHRKENQGSHESPTLNPETVAINLSDVDLSKYITTIAGVMTLSQVKGFVRKNGVNEAKIDEIKNDNVQDTAEQKVQLLRNWHQLHGKKEAYDTLIKDLKKANLCTLAEKIQTIILKDITSDSENSNFRNEIQSLV |
| Research Area | Cell Biology |
| Source | in vitro E.coli expression system |
| Gene Names | FAS |
| Protein Names | Recommended name: Tumor necrosis factor receptor superfamily member 6Alternative name(s): Apo-1 antigen Apoptosis-mediating surface antigen FAS FASLG receptor CD_antigen= CD95 |
| Expression Region | 26-335aa |
| Tag Info | N-terminal 10xHis-tagged |
| Mol. Weight | 40.6 kDa |
| Protein Description | Full Length of Mature Protein |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Receptor for TNFSF6/FASLG. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. FAS-mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both. The secreted isoforms 2 to 6 block apoptosis (in vitro). |
| Involvement in disease | Autoimmune lymphoproliferative syndrome 1A (ALPS1A) |
| Subcellular Location | Isoform 1: Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 2: Secreted, SUBCELLULAR LOCATION: Isoform 3: Secreted, SUBCELLULAR LOCATION: Isoform 4: Secreted, SUBCELLULAR LOCATION: Isoform 5: Secreted, SUBCELLULAR LOCATION: Isoform 6: Secreted |
| Tissue Specificity | Isoform 1 and isoform 6 are expressed at equal levels in resting peripheral blood mononuclear cells. After activation there is an increase in isoform 1 and decrease in the levels of isoform 6. |
| Database Links |
HGNC: 11920 OMIM: 134637 KEGG: hsa:355 STRING: 9606.ENSP00000347979 UniGene: Hs.244139 |
| Pathway |
MAPK signaling pathway
p53 signaling pathway TNF signaling pathway Apoptosis Necroptosis Natural killer cell mediated cytotoxicity |
Regarding your protein CSB-CF008433HU, could you please provide some informations?
Also, have you had any customers order this protein before? If so, could you please advise on the purity obtained? Would you be able to provide a representative COA?
QVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSNLGWLCLLLLPIPLIVWVKRKEVQKTCRKHRKENQGSHESPTLNPETVAINLSDVDLSKYITTIAGVMTLSQVKGFVRKNGVNEAKIDEIKNDNVQDTAEQKVQLLRNWHQLHGKKEAYDTLIKDLKKANLCTLAEKIQTIILKDITSDSENSNFRNEIQSLV
QVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSR
FAS Antibodies for Homo sapiens (Human)
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA06354C0Rb | FAS Antibody, FITC conjugated | Human | ELISA |
| CSB-PA06354B0Rb | FAS Antibody, HRP conjugated | Human | ELISA |
| CSB-PA06354D0Rb | FAS Antibody, Biotin conjugated | Human | ELISA |
| CSB-PA146193 | FAS Antibody | Human | ELISA,WB |
| CSB-PA942791 | FAS Antibody | Human | ELISA,WB,IHC |
| CSB-PA001488 | FAS Antibody | Human | WB,IHC,ELISA |
| CSB-PA002481 | FAS Antibody | Human | WB,IF,ELISA |
| CSB-PA006041 | FAS Antibody | Human | WB,ELISA |
| CSB-PA009527 | Phospho-FAS (Y291) Antibody | Human | IF,ELISA |
| CSB-PA185779 | FAS Antibody | Human | ELISA,WB,IHC |
FAS Antibodies for Human
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA06354A0Rb | FAS Antibody | Human | ELISA, IHC, IF |
FAS Proteins for Homo sapiens (Human)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP008433HU CSB-EP008433HU CSB-BP008433HU CSB-MP008433HU |
Recombinant Human Tumor necrosis factor receptor superfamily member 6(FAS),partial | Yeast E.coli Baculovirus Mammalian cell |
| CSB-AP002311HU | Recombinant Human Tumor necrosis factor receptor superfamily member 6 protein(FAS) (Active) | E.coli |
FAS ELISA Kit for Homo sapiens (Human)
| Code | Product Name | Sample Types | Sensitivity |
|---|---|---|---|
| CSB-E04542h | Human Factor-related Apoptosis,FAS ELISA Kit | serum, plasma, tissue homogenates | 7.8 pg/mL |
-SDS.jpg)
Recombinant Human Platelet glycoprotein Ib alpha chain(GP1BA),partial
Express system: Yeast
Species:
Recombinant Human Protein mago nashi homolog(MAGOH)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human T-cell surface glycoprotein CD8 alpha chain(CD8A),partial
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human Butyrophilin subfamily 3 member A3(BTN3A3),partial
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human Transcription intermediary factor 1-alpha(TRIM24),partial
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human Uncharacterized protein C21orf2(C21orf2)
Express system: E.coli
Species: Homo sapiens (Human)
-SDS.jpg)