Code | CSB-CF008433HU(A4) |
MSDS | |
Size | $1620 |
Order now | |
Image | |
Have Questions? | Leave a Message or Start an on-line Chat |
The recombinant Human FAS protein is a cell-free system in vitro E.coli expressed protein (Full Length of Mature Protein). In cell-free systems, synthesis of the protein can be carried out in vitro using extracts of whole cells that are compatible with translation. These cell extracts contain all the molecules and enzymes that are needed to transcribe, translate, and post-translationally modify the recombinant protein. With additional supplements of cofactors, FAS proteins can be formed in a few hours. However, this system may not be applicable for the large-scale production of recombinant proteins. Advantages of this system include that proteins can be synthesized without cell culturing; also, it is possible to express many proteins together.
FAS, also known as APO-1/CD95/TNFRSF6, is abundantly expressed in the thymus, liver, heart, and kidney. FAS-FASL interactions result in the formation of a death-inducing signaling complex (DISC) in the FAS-expressing cells, inducing apoptosis. Mutations in FAS receptors are linked to a loss of apoptotic signaling and have been found in an autoimmune disorder autoimmune lymphoproliferative syndrome (ALPS) type Ia. Furthermore, FAS is considered a tumor suppressor because deletions and mutations of FAS have been reported in many cancers. FAS engagement has recently been shown to elicit nonapoptotic signals that promote inflammation and carcinogenesis.There are currently no reviews for this product.
Regarding your protein CSB-CF008433HU, could you please provide some informations?
Also, have you had any customers order this protein before? If so, could you please advise on the purity obtained? Would you be able to provide a representative COA?
QVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSNLGWLCLLLLPIPLIVWVKRKEVQKTCRKHRKENQGSHESPTLNPETVAINLSDVDLSKYITTIAGVMTLSQVKGFVRKNGVNEAKIDEIKNDNVQDTAEQKVQLLRNWHQLHGKKEAYDTLIKDLKKANLCTLAEKIQTIILKDITSDSENSNFRNEIQSLV
QVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSR