Recombinant Human Tumor necrosis factor receptor superfamily member 6(FAS)

Code CSB-CF008433HU(A4)
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P25445
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence QVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSNLGWLCLLLLPIPLIVWVKRKEVQKTCRKHRKENQGSHESPTLNPETVAINLSDVDLSKYITTIAGVMTLSQVKGFVRKNGVNEAKIDEIKNDNVQDTAEQKVQLLRNWHQLHGKKEAYDTLIKDLKKANLCTLAEKIQTIILKDITSDSENSNFRNEIQSLV
Research Area Cell Biology
Source in vitro E.coli expression system
Gene Names FAS
Protein Names Recommended name: Tumor necrosis factor receptor superfamily member 6Alternative name(s): Apo-1 antigen Apoptosis-mediating surface antigen FAS FASLG receptor CD_antigen= CD95
Expression Region 26-335aa
Tag Info N-terminal 10xHis-tagged
Mol. Weight 40.6 kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for TNFSF6/FASLG. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. FAS-mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both. The secreted isoforms 2 to 6 block apoptosis (in vitro).
Involvement in disease Autoimmune lymphoproliferative syndrome 1A (ALPS1A)
Subcellular Location Isoform 1: Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 2: Secreted, SUBCELLULAR LOCATION: Isoform 3: Secreted, SUBCELLULAR LOCATION: Isoform 4: Secreted, SUBCELLULAR LOCATION: Isoform 5: Secreted, SUBCELLULAR LOCATION: Isoform 6: Secreted
Tissue Specificity Isoform 1 and isoform 6 are expressed at equal levels in resting peripheral blood mononuclear cells. After activation there is an increase in isoform 1 and decrease in the levels of isoform 6.
Database Links

HGNC: 11920

OMIM: 134637

KEGG: hsa:355

STRING: 9606.ENSP00000347979

UniGene: Hs.244139

Pathway MAPK signaling pathway
p53 signaling pathway
TNF signaling pathway
Apoptosis
Necroptosis
Natural killer cell mediated cytotoxicity

Q&A and Customer Reviews

Q&A
Q:

Regarding your protein CSB-CF008433HU, could you please provide some informations?
Also, have you had any customers order this protein before? If so, could you please advise on the purity obtained? Would you be able to provide a representative COA?

A:
Very nice to receive your inquiry. This is a transmembrane protein that we can only provide the full length protein with cell free expression system and provide the partial protein with four regular expression systems, such as E.coli, Yeast, Baculovirus and Mammalian cell.
Recombinant Human Tumor necrosis factor receptor superfamily member 6(FAS)
CSB-CF008433HU(A4)
Expression Region: 26-335aa; Full length of the mature protein.
Tag information:Tag type will be determined during the manufacturing process. (The expected tag is N-terminal 10xHis-tagged)
Sequence:

QVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSNLGWLCLLLLPIPLIVWVKRKEVQKTCRKHRKENQGSHESPTLNPETVAINLSDVDLSKYITTIAGVMTLSQVKGFVRKNGVNEAKIDEIKNDNVQDTAEQKVQLLRNWHQLHGKKEAYDTLIKDLKKANLCTLAEKIQTIILKDITSDSENSNFRNEIQSLV


In addition, below are the information about the partial protein expressed by the four regular expression systems:
Recombinant Human Tumor necrosis factor receptor superfamily member 6(FAS),partial
CSB-YP008433HU >> Yeast
CSB-EP008433HU >> E.coli
CSB-BP008433HU >> Baculovirus
CSB-MP008433HU >> Mammalian cell
Expression Region: 26-171aa; Partial.
Tag information:EP, YP, BP, MP: Tag type will be determined during the manufacturing process.
The expected tag for each expression system is listed as follows:
YP: N-terminal 6xHis-tagged; EP, BP, MP: N-terminal 10xHis-tagged and C-terminal Myc-tagged.
Sequence:

QVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSR


Sorry, all of them are semi-custom proteins that we haven't expressed before, so no customer ordered and the COA is not available for the time being.
We can guarantee that the final purity will be more than 85%, if you have higher requirement for the purity, please also communicate with us in advance, we can try as high purity as possible, but we just can't 100% guarantee the purity shown on the COA can reach 90% or 95%.
Customer Reviews

Related Products

FAS Antibodies

FAS Antibodies for Homo sapiens (Human)

FAS Antibodies for Human

FAS Proteins

FAS Proteins for Homo sapiens (Human)

FAS ELISA Kit

FAS ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.