Recombinant Mouse Pro-epidermal growth factor (Egf), partial (Active)

In Stock
Code CSB-AP004091MO
Abbreviation Recombinant Mouse Egf protein, partial (Active)
MSDS
Size $48
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Activity
The ED50 as determined by its ability to inhibits the proliferation of human epithelial A431 cells is 2-20 ng/ml.
Target Names
Uniprot No.
Research Area
Signal Transduction
Alternative Names
EgfPro-epidermal growth factor; EGF) [Cleaved into: Epidermal growth factor]
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
977-1029aa
Complete Sequence
NSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR
Mol. Weight
7.2 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Lyophilized powder
Buffer
Lyophilized from a 0.2 μm filtered 20mM Tris-HCl, 150mM NaCl, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Epidermal growth factor is a critical mitogenic signal that drives epithelial cell proliferation and wound healing through EGFR activation, making validated potency essential for reliable downstream results. This recombinant mouse EGF, spanning residues 977–1029 of the pro-EGF precursor, encompasses the mature ligand domain and demonstrates an ED50 of 2–20 ng/mL in A431 cell proliferation inhibition assays, confirming strong receptor-binding potency suitable for cell proliferation and survival assays, wound healing models, and EGFR-ligand competition studies via ELISA or SPR. The E. coli expression system yields a non-glycosylated protein with a C-terminal 6xHis tag, providing a well-defined molecule that eliminates glycosylation variability — an advantage for quantitative receptor-binding experiments and use as an ELISA standard for antibody characterization. Purity exceeding 95% by SDS-PAGE combined with endotoxin levels below 1.0 EU/μg satisfies the criteria typical for cell-based bioassays and in vivo tumor biology studies.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and of some fibroblasts in cell culture. Magnesiotropic hormone that stimulates magnesium reabsorption in the renal distal convoluted tubule via engagement of EGFR and activation of the magnesium channel TRPM6.
Gene References into Functions
  1. In mice, both EGF and pimecrolimus groups showed less erythema with significantly reduced inflammation and decreased expression of thymic stromal lymphopoietin. EGF relieved S. aureus-induced inflammation and AD-like skin lesions in Nc/Nga mice. PMID: 29862299
  2. hijacks miR-198/FSTL1 wound-healing switch and steers a two-pronged pathway toward metastasis PMID: 28827448
  3. These results indicate that Kindlin-1 is essential in EGF-induced re-epithelialization in skin wound healing and provide additional rationale for the clinical application of EGF in the treatment of acute wounds. PMID: 28290610
  4. concentration of EGF is critical for the switch between hair follicle growth and inhibition, and EGF promotes DP cell proliferation via Notch signaling pathway PMID: 27109378
  5. EGF promotes FoxM1 expression through the ERK signal pathway PMID: 26022336
  6. Data indicate that Sonic hedgehog (Shh) stimulate branching morphogenesis (BrM) and induced synthesis of mRNAs for Ptch1 protein, epidermal growth factor (EGF) and receptors of the ErbB receptors ErbB1, ErbB2 and ErbB3. PMID: 26930157
  7. Either LIF or EGF is needed during development of pre-implantation embryo. PMID: 27096934
  8. PXR activation stimulates EGF-mediated hepatocyte proliferation in mice, at least in part, through inhibiting FOXO3 from accelerating cell-cycle progression. PMID: 26574435
  9. Data (including data from studies in knockout mice) suggest that Epab (embryonic poly(A)-binding protein), which is oocyte specific, is required for ability of cumulus cells and granulosa cells to exhibit responsiveness to Egf/Egfr signaling. PMID: 26492470
  10. modulation of EGF signaling affects in vitro expansion and differentiation of progenitors from embryonic pancreas of both mice and man. PMID: 25925840
  11. TLR4 blockade prevented TPN-associated intestinal mucosa atrophy by preserving proliferation and preventing apoptosis. This is driven by a reduction in TNF-alpha abundance and increased EGF. PMID: 25782989
  12. EGF is required for cardiac differentiation of P19CL6 cells through interaction with GATA-4 in a time- and dose-dependent manner. PMID: 25504289
  13. These data demonstrate that Mcl-1 is essential for mammopoiesis and identify EGF as a critical trigger of Mcl-1 translation to ensure survival of milk-producing alveolar cells. PMID: 25730472
  14. results indentify EGF signalling as a robust vasculogenic inductive pathway for ATMCs, leading to their transdifferentiation into functional VSMC-like cells. PMID: 24967966
  15. MEKK1 PHD controls p38 and JNK activation during TGF-beta, EGF and microtubule disruption signalling, but does not affect MAPK responses to hyperosmotic stress. PMID: 25260751
  16. VEGFR1-mediated signaling plays a critical role in gastric ulcer healing and angiogenesis through enhanced EGF expression on VEGFR1+CXCR4+ cells PMID: 23982810
  17. The combination of EGF-FGF2 stimulates the proliferation. PMID: 24907656
  18. IL-6 may act as a new potential cumulus expansion-related transcript, which may be involved in the integration of TrkA and EGF signaling in affecting expansion of cumulus oocyte complexes. PMID: 24215827
  19. EGF treatment increases Cx43 phosphorylation up to 4-fold and induces efficient gap junction endocytosis. PMID: 24492000
  20. A previously unrecognized protective role is played by EGF in atopic dermatitis. EGF also has a new role in modulating IL-17 responses in the skin. PMID: 24337738
  21. Insulin treatment resulted in increased vascular leakage apparently mediated by betacellulin and signaling via the epidermal growth factor (EGF) receptor. PMID: 23831329
  22. While EGF activated Gab1 and Shc equally, within the same concentration range, HGF very potently and almost exclusively activated Gab1, having only a minimal effect on Shc PMID: 24126105
  23. These results support the argument that aberrant hyper-signals of EGF have significant impact on mouse behavioral traits and dopamine metabolism. PMID: 23669645
  24. Data indicate that LTB4 receptor type 1 (BLT1)-knockout mice showed delayed liver repair and a 70-80% attenuation in expression of epidermal growth factor (EGF), vascular endothelial growth factor (VEGF), and VEGF receptor 1 (VEGFR1). PMID: 23629862
  25. Data suggest Egf/Egf receptor signaling in cumulus cells (CC) downregulates Npr2 (natriuretic peptide receptor 2), decreases cGMP, elevates calcium, and induces meiotic resumption/oogenesis in cultured CC-oocyte complexes (in induced meiotic arrest). PMID: 23787120
  26. EGF and insulin/IGF prime endometrial epithelial cells to direct the mitogenic effects of estradiol. Furthermore, PTEN deficiency results in enhanced responsiveness to this combination, leading to hyperplasia of endometrial cells. PMID: 23669345
  27. Upregulation of endogenous EGF may act on top of an endocrinous cascade orchestrating the interactions between Sertoli cells and germ cells and may operate as defensive mechanism in response to testicular ischemia/reperfusion stress. PMID: 23241343
  28. study elucidated a previously unknown function of EGF in promoting hematopoietic stem cell regeneration after radiation-induced myelosuppression PMID: 23377280
  29. Suggest that FAK acts as a central coordinator of integrin and growth factor-mediated S-phase entry by regulating Cdk2 in EGF-stimulated hepatocytes. PMID: 23168795
  30. a novel link between EGF receptor stimulation, ILK-containing complexes, and activation of small Rho GTPases necessary for acquisition of front-rear polarity and forward movement PMID: 22160594
  31. The effects of EGF, insulin, and insulin-like growth factor (IGF)-1 correlate with reactive oxyen species (ROS) production in kidney cortical collecting duct cells. PMID: 23135700
  32. nucleobindin-2 regulates EGF-stimulated MAPK kinase/Erk signaling, cell proliferation, and adipocyte differentiation PMID: 22514047
  33. Neurotensin increases EGF expression in skin dendritic cells. PMID: 21767580
  34. It was suggested that, in this in vitro mouse model, EGF signaling during ovulation might protect the cumulus cells from the potential luteinizing effects of LH. PMID: 21293035
  35. Enteric glia promote intestinal mucosal healing via activation of focal adhesion kinase and release of proEGF. PMID: 21350188
  36. Rac1 through NADPH oxidase is part of the signaling pathway constituted by FAK, Rac1, and ERK that regulates focal adhesion disassembly during cell spreading. PMID: 21660950
  37. A switch in autocrine signaling to foster tumor growth that was initially triggered by EGF. PMID: 21464922
  38. The Tgf-beta(3) null mutant mouse palate presents several cellular anomalies that lead to the appearance of cleft palate reveals misexpression of EGF and Msx-1. PMID: 20881363
  39. Proprotein convertase PC7 enhances the activation of the EGF receptor pathway through processing of the EGF precursor. PMID: 21209099
  40. EGF signaling is indispensable for activation of proliferation and inhibition of unexpected cell death in intestinal epithelial cells PMID: 20714325
  41. EGF-induced MAPK signaling inhibits hemidesmosome formation through phosphorylation of the integrin beta 4. PMID: 20870721
  42. EGF/EGR-1 repressed transcriptional activation of the MMP-9 gene by stromal cells. PMID: 20472833
  43. 7,3',4'-Trihydroxyisoflavone inhibits epidermal growth factor-induced cell proliferation and transformation by suppressing cyclin-dependent kinases and phosphatidylinositol 3-kinase PMID: 20444693
  44. Phosphatidylinositol 4,5-bisphosphate activates Slo3 currents and its hydrolysis underlies the epidermal growth factor-induced current inhibition PMID: 20392696
  45. regulation of beta1-integrin expression/localization is involved in cellular processes, such as proliferation, induced by bFGF and EGF in mouse neuroepithelial cells PMID: 20371608
  46. conclude that neural stem/progenitor cell subpopulations reside in neurospheres that are distinguishable by their responsiveness to fibroblast growth factor-2 and EGF which is differentially regulated by chondroitin sulfate-carbohydrate structures. PMID: 20087964
  47. Palmitoylated EGFR exhibited only low-affinity EGF binding and impaired signal transduction. PMID: 19196031
  48. GH modulates EGF signaling in the liver. PMID: 20032199
  49. EGF is a key regulator of cell growth and development and a sevenfold increase is shown in EGF expression in FVB compared to B10.Q mice. PMID: 20080754
  50. Absence of post-translational aspartyl beta-hydroxylation of domains in mice leads to developmental defects and an increased incidence of intestinal neoplasia PMID: 11773073

Show More

Hide All

Subcellular Location
Membrane; Single-pass type I membrane protein.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*