Purity
            Greater than 95% as determined by SDS-PAGE.
           
                              
            Endotoxin
            Less than 1.0 EU/μg as determined by LAL method.
           
                              
            Activity
            The ED50 as determined by its ability to inhibits the proliferation of human epithelial A431 cells is 2-20 ng/ml.
           
                              
                                                  
                                        
            Research Area
            Signal Transduction
           
                              
            Alternative Names
            
              EgfPro-epidermal growth factor; EGF) [Cleaved into: Epidermal growth factor]
             
           
                                        
            Species
            Mus musculus (Mouse)
           
                              
                              
            Expression Region
            977-1029aa
           
                              
            Complete Sequence            
            NSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR            
           
                              
                              
                                        
            Tag Info
            
                                          C-terminal 6xHis-tagged
                          
           
                              
                    
            Buffer
                          Lyophilized from a 0.2 μm filtered 20mM Tris-HCl, 150mM NaCl, pH 8.0.                          
           
                                                  
            Reconstitution
            We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
           
                    
                    
            Storage Condition
            Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid
              repeated freeze-thaw
              cycles.
           
                              
            Shelf Life
            The shelf life is related to many factors, storage state, buffer ingredients, storage
              temperature
              and the stability of the protein itself.
              Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
              form is 12 months at -20°C/-80°C. 
           
                    
            Lead Time
            Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.            
           
                    
            Notes
            Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
           
                    
            Datasheet & COA
             Please contact us to get it.