Recombinant Mouse Pro-epidermal growth factor(Egf),partial

In Stock
Code CSB-AP004091MO
Product Type Growth Factor
Size US$33
Uniprot No. P01132
Lead Time 5-10 business days
Storage Buffer Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
Alias Pro-epidermal growth factor; Epidermal growth factor;EGF
Species Mus musculus (Mouse)
Biological_Activity The ED50 as determined in a cell proliferation assay using BALB/c 3T3 cells is less than 5 ng/ml.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence NSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR
Research Area Signal Transduction
Source E.coli
Gene Names Egf
Expression Region 977-1029aa
Tag Info C-terminal 6xHis-tagged
Mol. Weight 7.2 kDa
Protein Description Partial
Still Have Questions? Leave a Message or Start an on-line Chat
Function EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and of some fibroblasts in cell culture. Magnesiotropic hormone that stimulates magnesium reabsorption in the renal distal convoluted tubule via engagement of EGFR and activation of the magnesium channel TRPM6 (By similarity).
Subcellular Location Membrane, Single-pass type I membrane protein
Database Links

KEGG: mmu:13645

STRING: 10090.ENSMUSP00000029653

UniGene: Mm.252481

Related Products

Egf ELISA Kit

Egf ELISA Kit for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.