Recombinant Human Sepiapterin reductase(SPR)

Code CSB-EP022605HU
Product Type Recombinant Protein
Size US$2466
Uniprot No. P35270
Relevance Catalyzes the final one or two reductions in tetra-hydrobiopterin biosynthesis to form 5,6,7,8-tetrahydrobiopterin.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence MEGGLGRAVCLLTGASRGFGRTLAPLLASLLSPGSVLVLSARNDEALRQLEAELGAERSGLRVVRVPADLGAEAGLQQLLGALRELPRPKGLQRLLLINNAGSLGDVSKGFVDLSDSTQVNNYWALNLTSMLCLTSSVLKAFPDSPGLNRTVVNISSLCALQPFKGWALYCAGKAARDMLFQVLALEEPNVRVLNYAPGPLDTDMQQLARETSVDPDMRKGLQELKAKGKLVDCKVSAQKLLSLLEKDEFKSGAHVDFYDK
Research Area Signal Transduction
Source E.coli
Gene Names SPR
Protein Names Recommended name: Sepiapterin reductase Short name= SPR EC= 1.1.1.153
Expression Region 1-261aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 32.0 kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Catalyzes the final one or two reductions in tetra-hydrobiopterin biosynthesis to form 5,6,7,8-tetrahydrobiopterin.
Involvement in disease Dystonia, DOPA-responsive, due to sepiapterin reductase deficiency (DRDSPRD)
Subcellular Location Cytoplasm
Protein Families Sepiapterin reductase family
Database Links

HGNC: 11257

OMIM: 182125

KEGG: hsa:6697

STRING: 9606.ENSP00000234454

UniGene: Hs.301540

Related Products

SPR Antibodies

SPR Antibodies for Homo sapiens (Human)

SPR Proteins

SPR Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.