Recombinant Mouse Tumor necrosis factor(Tnf),partial (Active)

In Stock
Code CSB-AP005031MO
Product Type Tumor Necrosis Factor
Size $137Purchase it in Cusabio online store
(Shop online in the US. Customers outside the US,
please order from local distributors.)
Uniprot No. P06804
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
Alias Tumor Necrosis Factor; Cachectin; TNF-Alpha; Tumor Necrosis Factor Ligand Superfamily Member 2; TNF-a; Tumor Necrosis Factor; Membrane Form; Tumor Necrosis Factor; Soluble Form; Tnf; Tnfa; Tnfsf2
Species Mus musculus (Mouse)
Biological_Activity The ED50 as determined in a cytotoxicity assay using L?929 mouse fibroblast cells is less than 0.08 ng/ml in the presence of the metabolic inhibitor actinomycin D.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence DKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL
Research Area Cancer
Source E.coli
Gene Names Tnf
Expression Region 89-235aa
Tag Info Tag-Free
Mol. Weight 16.4 kDa
Protein Description Partial
Still Have Questions? Leave a Message or Start an on-line Chat
Function Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation.; FUNCTION
Subcellular Location Cell membrane, Single-pass type II membrane protein, SUBCELLULAR LOCATION: Tumor necrosis factor, membrane form: Membrane, Single-pass type II membrane protein, SUBCELLULAR LOCATION: Tumor necrosis factor, soluble form: Secreted, SUBCELLULAR LOCATION: C-domain 1: Secreted, SUBCELLULAR LOCATION: C-domain 2: Secreted
Protein Families Tumor necrosis factor family
Database Links

KEGG: mmu:21926

STRING: 10090.ENSMUSP00000025263

UniGene: Mm.1293

Pathway MAPK signaling pathway
mTOR signaling pathway
TGF-beta signaling pathway
NF-kappa B signaling pathway
TNF signaling pathway
Apoptosis
Necroptosis
Antigen processing and presentation
Fc epsilon RI signaling pathway
Hematopoietic cell lineage
IL-17 signaling pathway
Natural killer cell mediated cytotoxicity
NOD-like receptor signaling pathway
Osteoclast differentiation
T cell receptor signaling pathway
Toll-like receptor signaling pathway
Adipocytokine signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Inflammatory Pain

Related Products

Tnf Antibodies

Tnf Antibodies for Mus musculus (Mouse)

Tnf Proteins

Tnf Proteins for Mus musculus (Mouse)

Tnf ELISA Kit

Tnf ELISA Kit for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.