Recombinant Mouse Mast/stem cell growth factor receptor Kit (Kit), partial

Code CSB-YP012375MO
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP012375MO
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP012375MO-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP012375MO
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥85% (SDS-PAGE)
Target Names
Uniprot No.
Alternative Names
Kit; SlMast/stem cell growth factor receptor Kit; SCFR; EC 2.7.10.1; Proto-oncogene c-Kit; Tyrosine-protein kinase Kit; CD antigen CD117
Species
Mus musculus (Mouse)
Protein Length
Partial
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

Do you have Mouse KIT, also known as c-Kit or CD117 protein, his tagged? We are looking for the full length protein, amino acids 1-523. (NP_001116205.1). I looked on the website, but didn’t see it. We are looking for 100ug and lead times, if you have it.

A:
Very nice to receive your inquiry. 1. Recombinant Mouse Mast/stem cell growth factor receptor Kit(Kit)
Expression REgion: 25-527aa, complete extracellular domain
Tag Info: All the above four systems are tagged with 6xHis-tag.
Target Protein Sequence:

SQPSASPGEPSPPSIHPAQSELIVEAGDTLSLTCIDPDFVRWTFKTYFNEMVENKKNEWIQEKAEATRTGTYTCSNSNGLTSSIYVFVRDPAKLFLVGLPLFGKEDSDALVRCPLTDPQVSNYSLIECDGKSLPTDLTFVPNPKAGITIKNVKRAYHRLCVRCAAQRDGTWLHSDKFTLKVRAAIKAIPVVSVPETSHLLKKGDTFTVVCTIKDVSTSVNSMWLKMNPQPQHIAQVKHNSWHRGDFNYERQETLTISSARVDDSGVFMCYANNTFGSANVTTTLKVVEKGFINISPVKNTTVFVTDGENVDLVVEYEAYPKPEHQQWIYMNRTSANKGKDYVKSDNKSNIRYVNQLRLTRLKGTEGGTYTFLVSNSDASASVTFNVYVNTKPEILTYDRLINGMLQCVAEGFPEPTIDWYFCTGAEQRCTTPVSPVDVQVQNVSVSPFGKLVVQSSIDSSVFRHNGTVECKASNDVGKSSAFFNFAFKGNNKEQIQAHTLFTP


2. We could offer customize service for expression region 1-523aa. We will charge you step by step. Here we firstly provide details of E. coli system.
If you would like other expression system (Yeast, Baculovirus, Mammalian cell), we could also provide.
Code: CSB-EP012375MO1
Name: Recombinant Mouse Mast/stem cell growth factor receptor Kit(Kit)
Expression Region: 1-523aa, full length
Tag Info: N-terminal 6xHis-tag
Target Protein Sequence:

MRGARGAWDLLCVLLVLLRGQTATSQPSASPGEPSPPSIHPAQSELIVEAGDTLSLTCIDPDFVRWTFKTYFNEMVENKKNEWIQEKAEATRTGTYTCSNSNGLTSSIYVFVRDPAKLFLVGLPLFGKEDSDALVRCPLTDPQVSNYSLIECDGKSLPTDLTFVPNPKAGITIKNVKRAYHRLCVRCAAQRDGTWLHSDKFTLKVRAAIKAIPVVSVPETSHLLKKGDTFTVVCTIKDVSTSVNSMWLKMNPQPQHIAQVKHNSWHRGDFNYERQETLTISSARVDDSGVFMCYANNTFGSANVTTTLKVVEKGFINISPVKNTTVFVTDGENVDLVVEYEAYPKPEHQQWIYMNRTSANKGKDYVKSDNKSNIRYVNQLRLTRLKGTEGGTYTFLVSNSDASASVTFNVYVNTKPEILTYDRLINGMLQCVAEGFPEPTIDWYFCTGAEQRCTTPVSPVDVQVQNVSVSPFGKLVVQSSIDSSVFRHNGTVECKASNDVGKSSAFFNFAFKGNNKEQIQAHT


Uniprot Link: http://www.uniprot.org/uniprot/P05532

Step 1. Cost for Whole gene synthesis, Subcloning and Small - scale expression.
Step 2. Cost for Large-scale expression, Purification and Quality control.
If we succeed in step 1 and step 2, we will charge you,and provide you 1mg of purified protein.
If we finally fail in step 2, we will only charge you,and provide you constructed plasmid and strain.

Target Background

Function
Tyrosine-protein kinase that acts as cell-surface receptor for the cytokine KITLG/SCF and plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis. In response to KITLG/SCF binding, KIT can activate several signaling pathways. Phosphorylates PIK3R1, PLCG1, SH2B2/APS and CBL. Activates the AKT1 signaling pathway by phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase. Activated KIT also transmits signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. Promotes activation of STAT family members STAT1, STAT3, STAT5A and STAT5B. Activation of PLCG1 leads to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate. KIT signaling is modulated by protein phosphatases, and by rapid internalization and degradation of the receptor. Activated KIT promotes phosphorylation of the protein phosphatases PTPN6/SHP-1 and PTPRU, and of the transcription factors STAT1, STAT3, STAT5A and STAT5B. Promotes phosphorylation of PIK3R1, CBL, CRK (isoform Crk-II), LYN, MAPK1/ERK2 and/or MAPK3/ERK1, PLCG1, SRC and SHC1.
Gene References into Functions
  1. IGF-1 upregulated c-kit expression in c-kit-positive C-kit-positive cardiac stem cells (CSCs) resulting in enhanced CSC proliferation and migration by activating the PI3K/AKT/DNMT signaling pathway to epigenetically silence miR-193a, which negatively modifies the c-kit expression level. PMID: 29467020
  2. these observations imply that the expression of c-kit in the colonic epithelium is involved in the proliferation and permeability of the colonic epithelium. PMID: 29935985
  3. our study demonstrated that miR-143 mediates oxidative stress-induced autophagy to enhance the survival of c-kit(+) CPCs by targeting Atg7, which will provide a complementary approach for improving cardiac progenitor cells (CPCs)-based heart repair PMID: 29858017
  4. This study provides evidence that c-Kit signaling is required during arteriogenesis. Also, it strongly suggests a vascular role for c-Kit signaling because rescue of systemic c-Kit activity by bone marrow transplantation did not augment the functional recovery of Kit(W/W-v) mouse hindlimbs. PMID: 29287914
  5. The results of this study suggest that NAR relieves Lop-induced constipation by increasing the levels of interstitial cells of Cajal markers (c-Kit and SCF), as well as AQP3. Thus, NAR may be effective as a candidate in patients suffering from lifestyle-induced constipation. PMID: 29207043
  6. Among the cardiac c-kit(pos) cell cohort only a very small fraction has the phenotype and the differentiation/regenerative potential characteristics of true multipotent CSCs. PMID: 28800128
  7. data suggest that c-Kit negatively regulates bone turnover, and disrupted c-Kit signaling couples increased bone resorption with bone formation through osteoclast-derived Wnt 10 b PMID: 27527615
  8. Kit mutation is associated with gastrointestinal stromal tumor. PMID: 28923937
  9. Data collectively argue that mutations perturbing SCO1 function have tissue-specific consequences for the machinery that ultimately governs copper homeostasis, and further establish the importance of aberrant mitochondrial signaling to the etiology of copper handling disorders. PMID: 28973536
  10. After intestinal myenteric plexus ablation with benzalkonium chloride, adult neurogenesis was significantly induced in c-kit loss-of-function mutant mice (W/W(v)). Imatinib induced appearance of ectopic neurons after BAC treatment, even in wildtype mice. Adult neurogenesis in the enteric nervous system is negatively regulated by c-Kit signaling in vivo. PMID: 27572504
  11. This study indicated that c-Kit could be used as a potential therapeutic target for treatment of cardiac fibrosis. PMID: 28780584
  12. Activation of c-kit signalling by SCF promotes migration of cardiac stem cells with increased phosphorylation of CXCR4-serine 339, p38 mitogen-activated protein kinase (p38 MAPK) and extracellular regulated protein kinases 1/2 (ERK1/2). PMID: 27245949
  13. exposure of HSPCs to SCF and diminished number of c-Kit receptors in their cell membranes do not compromise the capacity of HSPCs to reconstitute damaged hematopoietic tissue. PMID: 27040393
  14. the stem cell gene Kit is regulated inversely from Krt5/Krt14 by RA signaling PMID: 27884045
  15. TPO and its receptor Mpl are dispensable for platelet survival in adult mice PMID: 27344013
  16. Artificially applied c-kit(+) cells interact with the target organ endothelium following ischemia reperfusion injury. This interaction seems to depend on TLR-MyD88 signaling. PMID: 28363496
  17. a critical role for PRL2 phosphatase in mediating Notch and c-Kit signals in early T cell progenitors, is reported. PMID: 28009085
  18. These results suggest that CD44(+)CD117(+) T cells are stem cells and a specific T-cell phenotype that initially develops in the thymus, but they do not progress through DN3 and DN4 stages, lack a DP stage, and potently suppress T-cell proliferation and modulate the CTLA-4 pathway. PMID: 28279199
  19. we studied the efficacy of ACK2, an antibody that blocks KIT, followed by low-dose irradiation as a preconditioning regimen for hematopoietic cell transplantation using a murine model of Mucopolysaccharidosis type II. PMID: 27590924
  20. Constitutive activation of c-Kit receptor in mice is associated with an increased cardiac myogenic and vasculogenic reparative potential after injury, with a significant improvement of survival. PMID: 27468693
  21. C-kit-positive hematopoietic stem/progenitor cells expressed significantly higher of Nox1 and catalase, but less of lactoperoxidase than in matured mononuclear cells. PMID: 25451257
  22. c-KIT signaling regulates self-renewal capacity and prevents neurodifferentiation in culture. PMID: 27789621
  23. These findings identify functional redundancy among Kit-dependent hematopoietic lineages and establish an unanticipated capacity of megakaryocytes to mediate IL-1-driven systemic inflammatory disease. PMID: 28375155
  24. WNT signaling at an early stage (E12-E15) of submandibular salivary gland (SMG) development inhibits end bud morphogenesis and differentiation into proacini by suppressing Kit expression. PMID: 27161149
  25. c-kit can reduce inflammation, positively modulate airway remodeling, and improve function in a mouse model of airway hyperresponsiveness PMID: 28090152
  26. Our KitD814V-triggered B-ALL mouse model might prove valuable for the identification of additional oncogenic mutations and mechanisms that may contribute to leukemogenesis in humans. PMID: 27664314
  27. Kit inactivation within oocytes also led to premature ovarian failure, albeit via a contrasting phenotype. Despite normal initial complements of primordial follicles, oocytes remained dormant with arrested oocyte maturation. Foxo3 protein localization in the nucleus versus cytoplasm explained both mutant phenotypes. PMID: 27500836
  28. sca-1 antibody reduces both CD34+/c-kit+ progenitor cell surge and vascular restenosis after endoluminal vascular injury in a murine model. PMID: 27666446
  29. These findings indicate the SCF/Kit signaling insufficiency may contribute to the underdevelopment of ICCs and intestinal motility dysfunction upon hypoxia exposure. PMID: 28315973
  30. we identified important roles for the GATA-2 C-ZnF in bone marrow hematopoiesis via control of c-Kit expression and HSC/HSPC survival. PMID: 26660446
  31. role of KIT in cutaneous mast cells in skin physiology and pathology PMID: 26268458
  32. IMC-G4 cells had an additional novel c-kit gene mutation of KIT-Tyr421Cys which is considered to induce neoplastic transformation of mouse mast cells PMID: 26722383
  33. This study presents a new interpretation for the contribution of Kit(+) cells to cardiomyocytes and shows that Kit genetic lineage tracing over-estimates the cardiogenic activity of Kit(+) cardiac stem cells. PMID: 26634606
  34. gene deficiency does not play a role in the pathogenesis of lupus in B6lpr/lpr mice. PMID: 25849740
  35. suggests FGF-9 has the potential to attenuate vascular cell apoptosis, activate c-Kit progenitor cells, and enhance angiogenesis and neovascularization in C57BL/6 and db/db mice leading to improved cardiac function. PMID: 26682010
  36. Bone marrow-derived CD117+ hematopoietic progenitor cells differentiate into thymic dendritic cells in the fetal thymus organ culture system in the presence of Flt3L. PMID: 26397863
  37. C-kit signaling has a role in proliferation and invasion of colorectal mucinous adenocarcinoma PMID: 26356816
  38. House dust mite allergens mediate the activation of ckit in dendritic cells via Tolllike receptor 2. PMID: 26238189
  39. Dynamic process of early thymic progenitor differentiation is paralleled by migration-dependent change to the supporting niche, and identify vascular endothelial cells as a thymic niche cell, with mKitL as a critical ligand. PMID: 26780297
  40. Findings indicate that CD45 antigen(+) and c-Kit protein(+) hematopoietic cells were more abundant in muscle than in bone marrow between embryonic 14.5 and 17.5 days. PMID: 26389592
  41. c-kit(+) cells in the murine heart are endothelial cells and not cardiac stem cells. PMID: 26515110
  42. As SALL4A is known to impair ZBTB16-mediated Kit repression [14], our study provides novel insights into the molecular mechanism by which ATRA could control KIT expression, and thereby the differentiation of Aal into A1 spermatogonia in vivo. PMID: 26427057
  43. Data show that PI3 kinase is an attractive therapeutic target in malignancies induced by proto-oncogene protein c-Kit mutations. PMID: 26040420
  44. Activation of KIT modulates the function of tumor necrosis factor-related apoptosis-inducing ligand receptor (TRAIL-R) in mast cells PMID: 25833810
  45. Embryonic stem cells - derived c-Kit+/Sca-1-cells can be differentiated through a Klf4/beta-catenin dependent pathway and are a suitable source of vascular progenitors for the creation of superior tissue-engineered vessels from decellularised scaffolds. PMID: 25985152
  46. SCF/c-kit signaling was required for TPA-induced migration and differentiation of hair follicle melanocytes. PMID: 25727244
  47. These results show that a crosstalk between Kit and erythropoietin receptor signaling cascades exists and that continuous Kit signaling, partly mediated by the MAPK pathway, interferes with this crosstalk. PMID: 25323585
  48. gene deficiency results in resistance to induction of intravenous tolerance in experimental autoimmune encephalomyelitis PMID: 25588867
  49. Data indicate that proto-oncogene protein Kit(w-sh) mice showed an unaltered capacity to develop lung pathology and increased mucus production in response to house dust mite (HDM). PMID: 24157568
  50. expression in adipose tissues responsive to food availability and environmental temperature; expression altered in obese mice PMID: 24999927

Show More

Hide All

Involvement in disease
Defects in Kit are the cause of the white-spotting phenotype (W). White-spotting variants induces severe effects on pigmentation, gametogenesis and hematopoiesis. Mice homozygous for W42 die perinatally of macrocytic anemia.
Subcellular Location
[Isoform 1]: Cell membrane; Single-pass type I membrane protein.; [Isoform 2]: Cell membrane; Single-pass type I membrane protein.; [Isoform 3]: Cytoplasm.
Protein Families
Protein kinase superfamily, Tyr protein kinase family, CSF-1/PDGF receptor subfamily
Tissue Specificity
Isoform 1 and isoform 2 are detected in bone marrow cells, spermatogonia and spermatocytes, but not in round spermatids, elongating spermatids and spermatozoa. Isoform 3 is detected in round spermatids, elongating spermatids and spermatozoa, but not in sp
Database Links
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1