Recombinant Human Ubiquitin-like FUBI-ribosomal protein eS30 fusion protein (FAU)

In Stock
Code CSB-EP008447HU
Abbreviation Recombinant Human FAU protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
FAU
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
FAU; Ubiquitin-like protein FUBI
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-133aa
Target Protein Sequence
MQLFVRAQELHTFEVTGQETVAQIKAHVASLEGIAPEDQVVLLAGAPLEDEATLGQCGVEALTTLEVAGRMLGGKVHGSLARAGKVRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVVPTFGKKKGPNANS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
41.4kDa
Protein Length
Full Length
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human Ubiquitin-like FUBI-ribosomal protein eS30 fusion protein (FAU) is produced in E.coli and expressed as a full-length protein corresponding to amino acids 1-133. This product features an N-terminal GST tag, which helps with purification and detection. The protein shows purity greater than 90% as measured by SDS-PAGE, making it suitable for research applications that need high-quality reagents.

FAU protein, also called Ubiquitin-like FUBI-ribosomal protein eS30, appears to play a critical role in ribosome biogenesis and function. It's a component of the small 40S ribosomal subunit and seems to be involved in protein synthesis within cells. Understanding what FAU does in these basic processes may be essential for research into how cells grow and maintain themselves.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

FAU is a unique fusion protein where the ubiquitin-like FUBI domain must be properly processed by deubiquitinating enzymes to release functional ribosomal protein eS30. This protein requires specific folding for both domains and proper cleavage functionality. E. coli expression systems cannot replicate the eukaryotic cellular environment necessary for correct processing and may not support the proper folding of this complex fusion protein. The GST tag, while aiding solubility, may interfere with the native structure and processing requirements. No validation data (e.g., cleavage assays, ribosomal incorporation tests) are provided. Therefore, the protein's folding status and bioactivity cannot be confirmed.

1. Ribosome Biogenesis and Assembly Studies

If correctly folded and processable, the recombinant FAU could theoretically be used to study ribosome assembly, but E. coli expression is unlikely to produce a properly processed protein. If misfolded or non-cleavable, the fusion protein will not accurately represent the natural FUBI-eS30 processing pathway, leading to invalid conclusions about ribosomal incorporation mechanisms.

2. Deubiquitinating Enzyme Activity Assays

This application requires proper folding of both FUBI and eS30 domains. If correctly folded, the protein could serve as a DUB substrate, but if misfolded, enzyme cleavage studies would yield biologically irrelevant results, as the recognition and cleavage sites may be structurally compromised.

3. Protein-Protein Interaction Studies

If properly folded, GST-tagged FAU could be used for interaction studies, but if misfolded, interaction domains may be altered, leading to non-specific binding or failure to identify genuine biological partners involved in ribosome biogenesis.

4. Antibody Development and Validation

This application is suitable as antibody generation relies on linear epitopes. However, antibodies against misfolded protein may not optimally recognize the properly processed and incorporated eS30 in biological contexts.

5. Structural and Biophysical Characterization

If correctly folded, structural studies could provide insights, but if misfolded, data would misrepresent the native protein's architecture. The GST tag may dominate structural signals and interfere with accurate FAU domain analysis.

Final Recommendation & Action Plan

This E. coli-expressed GST-tagged FAU protein requires rigorous validation before functional applications. Recommended actions include: performing cleavage assays with known DUBs to verify processability; testing ribosomal incorporation capability; conducting biophysical characterization (circular dichroism, size-exclusion chromatography) to assess folding. If validation fails, consider eukaryotic expression systems that better support proper processing and folding. For reliable results, focus initial applications on antibody development and cautiously proceed with interaction studies only after confirming proper folding and processability.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

The molecular weight of this protein is 11k Da, but the actual product molecular weight is 40 kDa. I would like to know how this discrepancy is caused. Is it because of the GST tag?
In addition, please provide the complete sequence and molecular weight information of the protein. Thanks very much.

A:

The theoretical molecular weight of the target protein is 14.3kDa, the theoretical molecular weight of the fusion protein is 41.4kDa, and the SDS observation value is 44 kDa. Wherein, the fusion protein is the molecular weight including the tag.


The full sequence of CSB-RP018244h is as follows:
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSPEFRT+MQLFVRAQELHTFEVTGQETVAQIKAHVASLEGIAPEDQVVLLAGAPLEDEATLGQCGVEALTTLEVAGRMLGGKVHGSLARAGKVRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVVPTFGKKKGPNANS
GST-Tag:
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPK
PSP(Prescission Protease): LEVLFQGP
Linker: RT

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*