Home
Protein
Recombinant Protein
Recombinant Human Ubiquitin-like protein FUBI (FAU)

Recombinant Human Ubiquitin-like protein FUBI (FAU)

^{In Stock}

Code	CSB-RP018244h
MSDS	MSDS
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

FAU

Uniprot No.

NM_001997

Research Area

Epigenetics and Nuclear Signaling

Alternative Names

FAU; Ubiquitin-like protein FUBI

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

1-133aa

Target Protein Sequence

MQLFVRAQELHTFEVTGQETVAQIKAHVASLEGIAPEDQVVLLAGAPLEDEATLGQCGVEALTTLEVAGRMLGGKVHGSLARAGKVRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVVPTFGKKKGPNANS
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

41.4kDa

Protein Length

Full Length

Tag Info

N-terminal GST-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Tris-based buffer,50% glycerol

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The region for expressing recombinant Human FAU contains amino acids 1-133. This FAU protein is expected to have a theoretical molecular weight of 41.4 kDa. This FAU protein is produced using e.coli expression system. The N-terminal GST tag was fused into the coding gene segment of FAU, making it easier to detect and purify the FAU recombinant protein in the later stages of expression and purification.

The human ubiquitin-like protein FUBI is a member of the Finkel–Biskis–Reilly murine sarcoma virus (FBR-MuSV) ubiquitin-like family. Encoded by the FAU gene, FUBI is a small protein that shares structural similarities with ubiquitin. FUBI has been implicated in various cellular processes, including cell cycle regulation, apoptosis, and protein degradation. FUBI may interact with components of the proteasome and participate in ubiquitin-mediated protein degradation pathways. Research on FAU explores its role in cellular homeostasis, its potential regulatory functions, and its relevance to diseases such as cancer, where dysregulation of protein degradation pathways is often observed.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

■ Q&A

The molecular weight of this protein is 11k Da, but the actual product molecular weight is 40 kDa. I would like to know how this discrepancy is caused. Is it because of the GST tag?
In addition, please provide the complete sequence and molecular weight information of the protein. Thanks very much.

The theoretical molecular weight of the target protein is 14.3kDa, the theoretical molecular weight of the fusion protein is 41.4kDa, and the SDS observation value is 44 kDa. Wherein, the fusion protein is the molecular weight including the tag.

The full sequence of CSB-RP018244h is as follows:
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSPEFRT+MQLFVRAQELHTFEVTGQETVAQIKAHVASLEGIAPEDQVVLLAGAPLEDEATLGQCGVEALTTLEVAGRMLGGKVHGSLARAGKVRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVVPTFGKKKGPNANS
GST-Tag:
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPK
PSP(Prescission Protease): LEVLFQGP
Linker: RT

Promotions