Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

Lum

Uniprot No.

P51885

Research Area

Cancer

Alternative Names

Lum; Lcn; Ldc; Lumican; Keratan sulfate proteoglycan lumican; KSPG lumican

Species

Mus musculus (Mouse)

Source

E.coli

Expression Region

19-338aa

Target Protein Sequence

QYYDYDIPLFMYGQISPNCAPECNCPHSYPTAMYCDDLKLKSVPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGKVFSKLKQLKKLHINYNNLTESVGPLPKSLQDLQLTNNKISKLGSFDGLVNLTFIYLQHNQLKEDAVSASLKGLKSLEYLDLSFNQMSKLPAGLPTSLLTLYLDNNKISNIPDEYFKRFTGLQYLRLSHNELADSGVPGNSFNISSLLELDLSYNKLKSIPTVNENLENYYLEVNELEKFDVKSFCKILGPLSYSKIKHLRLDGNPLTQSSLPPDMYECLRVANEITVN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

44.0 kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Tris-based buffer,50% glycerol

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The synthesis of the recombinant plasmid containing the gene encoding the Mouse Lum protein (19-338aa) is the first step to produce the recombinant Mouse Lum protein. After that, the recombinant plasmid is transformed into e.coli cells. e.coli cells capable of enduring a specific antibiotic are selected, demonstrating successful uptake of the recombinant plasmid. The e.coli cells containing the recombinant plasmid are cultured under conditions that encourage the expression of the gene of interest. A N-terminal 10xHis tag and C-terminal Myc tag is linked to the protein. Following expression, affinity purification is employed to isolate and purify the recombinant Mouse Lum protein from the cell lysate. Denaturing SDS-PAGE is applied to resolve the resulting recombinant Mouse Lum protein, indicating a purity level exceeding 85%.

Target Background

Gene References into Functions

this study shows that Lum negatively regulates encephalitic TH17 cells, implicating a potential therapeutic pathway in TH17 cell mediated autoimmune and inflammatory diseases PMID: 27682997
ectopic mutant lumican (L199P) may induce enlargement of axial lengths and abnormal structures and distributions of collagen fibrils in mouse sclera PMID: 27711221
alternations of lumican might be implicated in the pathogenesis of cardiac fibrosis PMID: 27939890
LUM may coordinate multiple factors of collagen assembly in the murine heart. PMID: 25886697
Lumican and biglycan influence corneal keratocyte lamellipodia organization and are critical in the regulation of stromal collagen fibrillogenesis. PMID: 24447998
Alterations in glycosylated lumican core protein might be implicated in myocardial remodeling and reverse remodeling, with a potential important role for CS/DS GAG chain-synthesizing enzymes. PMID: 23412898
pro-inflammatory cytokine TNF-alpha was comparably low 24 hours after infection, but significantly higher in the Lum(-/-) compared to Lum(+/-) infected corneas by 2-5 days after infection PMID: 23358433
lumican present in the reactive stroma surrounding prostate primary tumors plays a restrictive role on cancer progression PMID: 23399832
To investigate the functional role of lumican in hepatic fibrosis, lumican null (Null) and wild-type (WT) littermates were administered carbon tetrachloride intra-peritoneally. Hepatic fibrosis was greatly reduced in null animals. PMID: 23007134
lumican has a major protective role in gram-negative bacterial infections, a novel function for small leucine-rich repeat proteoglycans. PMID: 22865855
deficiency combined with fibromodulin deficiency manifest several clinical features or Ehlers-Danlos syndrome PMID: 12089156
The results indicate that the cysteine-rich domain of lumican is important in collagen fibrillogenesis and stromal matrix assembly PMID: 12381269
the posterior stroma of the cornea, which is most vulnerable to lumican-deficiency, demonstrates an early developmental defect in fibril structure and architecture in the Lum-/- genotype PMID: 16786597
a novel role for lumican in the presentation of bacterial lipopolysaccharide to CD14 and host response to this bacterial endotoxin. PMID: 17616530
Lumican is identified as a novel regulator of angiogenesis. PMID: 17632767
Homologous sequence in lumican and fibromodulin leucine-rich repeat 5-7 competes for collagen binding. PMID: 19008226

Hide All

Subcellular Location

Secreted, extracellular space, extracellular matrix.

Protein Families

Small leucine-rich proteoglycan (SLRP) family, SLRP class II subfamily

Tissue Specificity

Cornea and other tissues.

Database Links

KEGG: mmu:17022

STRING: 10090.ENSMUSP00000040877

UniGene: Mm.18888

Code	CSB-EP013234MO
Abbreviation	Recombinant Mouse Lum protein
MSDS	MSDS Datasheet
Size	US$306
	Order now
Image	Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP013234MO could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Lum. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP013234MO could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Lum.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse Lumican (Lum)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage