Recombinant Marmota monax Tumor necrosis factor(TNF),partial

Code CSB-BP523593MQG
Product Type Recombinant Protein
Size Pls inquiry other sizes
Uniprot No. O35734
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Relevance Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation. The TNF intracellular domain (ICD) form induces IL12 production in dendritic cells.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Cachectin TNF-alpha Tumor necrosis factor ligand superfamily member 2
Species Marmota monax (Woodchuck)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence GPQREEFLNNLPLSPQAQMLTLRSSSQNMNDKPVAHVVAKNEDKEQLVWLSRRANALLANGMELIDNQLVVPANGLYLVYSQVLFKGQGCPSYVLLTHTVSRFAVSYQDKVNLLSAIKSPCPKESLEGAEFKPWYEPIYLGGVFELQKGDRLSAEVNLPSYLDFAESGQVYFGVIAL
Research Area Immunology
Source Baculovirus
Gene Names TNF
Expression Region 57-233aa
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Product Info N-terminal 10xHis-tagged
Mol. Weight 22.2kDa
Protein Description Partial
Still Have Questions? Leave a Message or Start an on-line Chat
Function Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation.; FUNCTION
Subcellular Location Cell membrane, Single-pass type II membrane protein, SUBCELLULAR LOCATION: Tumor necrosis factor, membrane form: Membrane, Single-pass type II membrane protein, SUBCELLULAR LOCATION: Tumor necrosis factor, soluble form: Secreted, SUBCELLULAR LOCATION: C-domain 1: Secreted, SUBCELLULAR LOCATION: C-domain 2: Secreted
Protein Families Tumor necrosis factor family
Pathway MAPK signaling pathway
mTOR signaling pathway
TGF-beta signaling pathway
NF-kappa B signaling pathway
TNF signaling pathway
Apoptosis
Necroptosis
Antigen processing and presentation
Fc epsilon RI signaling pathway
Hematopoietic cell lineage
IL-17 signaling pathway
Natural killer cell mediated cytotoxicity
NOD-like receptor signaling pathway
Osteoclast differentiation
T cell receptor signaling pathway
Toll-like receptor signaling pathway
Adipocytokine signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Inflammatory Pain

Related Products

TNF Antibodies

TNF Antibodies for Bos taurus (Bovine)

TNF Antibodies for Homo sapiens (Human)

TNF Antibodies for Mus musculus (Mouse)

TNF Antibodies for Rattus norvegicus (Rat)

TNF Antibodies for Oryctolagus cuniculus (Rabbit)

TNF Proteins

TNF Proteins for Mus musculus (Mouse)

TNF Proteins for Oryctolagus cuniculus (Rabbit)

TNF Proteins for Equus caballus (Horse)

TNF Proteins for Capra hircus (Goat)

TNF Proteins for Bos taurus (Bovine)

TNF Proteins for Macaca mulatta (Rhesus macaque)

TNF Proteins for Felis catus (Cat) (Felis silvestris catus)

TNF Proteins for Sus scrofa (Pig)

TNF Proteins for Ovis aries (Sheep)

TNF Proteins for Cavia porcellus (Guinea pig)

TNF Proteins for Canis lupus familiaris (Dog) (Canis familiaris)

TNF Proteins for Homo sapiens (Human)

TNF Proteins for Trichosurus vulpecula (Brush-tailed possum)

TNF Proteins for Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

TNF Proteins for Rattus norvegicus (Rat)

TNF Proteins for Papio sp. (Baboon)

TNF Proteins for Peromyscus leucopus (White-footed mouse)

TNF Proteins for Cervus elaphus (Red deer)

TNF Proteins for Bos indicus (Zebu)

TNF Proteins for Bubalus bubalis (Domestic water buffalo)

TNF Proteins for Lama glama (Llama)

TNF Proteins for Papio anubis (Olive baboon)

TNF Proteins for Marmota monax (Woodchuck)

TNF Proteins for Papio hamadryas ursinus (Chacma baboon)

TNF Proteins for Macropus eugenii (Tammar wallaby) (Notamacropus eugenii)

TNF Proteins for Callithrix jacchus (White-tufted-ear marmoset)

TNF Proteins for Boselaphus tragocamelus (Nilgai)

TNF Proteins for Dasypus novemcinctus (Nine-banded armadillo)

TNF Proteins for Bubalus carabanensis (Swamp type water buffalo) (Bubalus bubalis carabanensis)

TNF Proteins for Tupaia tana (Large tree shrew)

TNF Proteins for Camelus bactrianus (Bactrian camel)

TNF Proteins for Pan troglodytes (Chimpanzee)

TNF Proteins for Sparus aurata (Gilthead sea bream)

TNF Proteins for Saimiri sciureus (Common squirrel monkey)

TNF Proteins for Delphinapterus leucas (Beluga whale)

TNF Proteins for Tursiops truncatus (Atlantic bottle-nosed dolphin) (Delphinus truncatus)

TNF cDNA

TNF cDNA for Equus caballus (Horse)

TNF cDNA for Callithrix jacchus (White-tufted-ear marmoset)

TNF cDNA for Pan troglodytes (Chimpanzee)

TNF cDNA for Canis lupus familiaris (Dog) (Canis familiaris)

TNF cDNA for Cavia porcellus (Guinea pig)

TNF cDNA for Macaca mulatta (Rhesus macaque)

TNF cDNA for Papio anubis (Olive baboon)

TNF cDNA for Oryctolagus cuniculus (Rabbit)

TNF cDNA for Mus musculus (Mouse)

TNF cDNA for Felis catus (Cat) (Felis silvestris catus)

TNF cDNA for Ovis aries (Sheep)

TNF cDNA for Sus scrofa (Pig)

TNF ELISA Kit

TNF ELISA Kit for Bos taurus (Bovine)

TNF ELISA Kit for Canis lupus familiaris (Dog) (Canis familiaris)

TNF ELISA Kit for Capra hircus (Goat)

TNF ELISA Kit for Guinea Sus scrofa (Pig)

TNF ELISA Kit for Equus caballus (Horse)

TNF ELISA Kit for Homo sapiens (Human)

TNF ELISA Kit for Monkey

TNF ELISA Kit for Mus musculus (Mouse)

TNF ELISA Kit for Oryctolagus cuniculus (Rabbit)

TNF ELISA Kit for Rattus norvegicus (Rat)

TNF ELISA Kit for Ovis aries (Sheep)

TNF ELISA Kit for Sus scrofa (Pig)

Most popular with customers

+ Show More

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.

Wait!

Join the 25,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now!

We don't deal in spam.