Recombinant Mouse Lumican (Lum)

In Stock
Code CSB-EP013234MO
Abbreviation Recombinant Mouse Lum protein
MSDS
Size US$306
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Lum
Uniprot No.
Research Area
Cancer
Alternative Names
Lum; Lcn; Ldc; Lumican; Keratan sulfate proteoglycan lumican; KSPG lumican
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
19-338aa
Target Protein Sequence
QYYDYDIPLFMYGQISPNCAPECNCPHSYPTAMYCDDLKLKSVPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGKVFSKLKQLKKLHINYNNLTESVGPLPKSLQDLQLTNNKISKLGSFDGLVNLTFIYLQHNQLKEDAVSASLKGLKSLEYLDLSFNQMSKLPAGLPTSLLTLYLDNNKISNIPDEYFKRFTGLQYLRLSHNELADSGVPGNSFNISSLLELDLSYNKLKSIPTVNENLENYYLEVNELEKFDVKSFCKILGPLSYSKIKHLRLDGNPLTQSSLPPDMYECLRVANEITVN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
44.0 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The synthesis of the recombinant plasmid containing the gene encoding the Mouse Lum protein (19-338aa) is the first step to produce the recombinant Mouse Lum protein. After that, the recombinant plasmid is transformed into e.coli cells. e.coli cells capable of enduring a specific antibiotic are selected, demonstrating successful uptake of the recombinant plasmid. The e.coli cells containing the recombinant plasmid are cultured under conditions that encourage the expression of the gene of interest. A N-terminal 10xHis tag and C-terminal Myc tag is linked to the protein. Following expression, affinity purification is employed to isolate and purify the recombinant Mouse Lum protein from the cell lysate. Denaturing SDS-PAGE is applied to resolve the resulting recombinant Mouse Lum protein, indicating a purity level exceeding 85%.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Gene References into Functions
  1. this study shows that Lum negatively regulates encephalitic TH17 cells, implicating a potential therapeutic pathway in TH17 cell mediated autoimmune and inflammatory diseases PMID: 27682997
  2. ectopic mutant lumican (L199P) may induce enlargement of axial lengths and abnormal structures and distributions of collagen fibrils in mouse sclera PMID: 27711221
  3. alternations of lumican might be implicated in the pathogenesis of cardiac fibrosis PMID: 27939890
  4. LUM may coordinate multiple factors of collagen assembly in the murine heart. PMID: 25886697
  5. Lumican and biglycan influence corneal keratocyte lamellipodia organization and are critical in the regulation of stromal collagen fibrillogenesis. PMID: 24447998
  6. Alterations in glycosylated lumican core protein might be implicated in myocardial remodeling and reverse remodeling, with a potential important role for CS/DS GAG chain-synthesizing enzymes. PMID: 23412898
  7. pro-inflammatory cytokine TNF-alpha was comparably low 24 hours after infection, but significantly higher in the Lum(-/-) compared to Lum(+/-) infected corneas by 2-5 days after infection PMID: 23358433
  8. lumican present in the reactive stroma surrounding prostate primary tumors plays a restrictive role on cancer progression PMID: 23399832
  9. To investigate the functional role of lumican in hepatic fibrosis, lumican null (Null) and wild-type (WT) littermates were administered carbon tetrachloride intra-peritoneally. Hepatic fibrosis was greatly reduced in null animals. PMID: 23007134
  10. lumican has a major protective role in gram-negative bacterial infections, a novel function for small leucine-rich repeat proteoglycans. PMID: 22865855
  11. deficiency combined with fibromodulin deficiency manifest several clinical features or Ehlers-Danlos syndrome PMID: 12089156
  12. The results indicate that the cysteine-rich domain of lumican is important in collagen fibrillogenesis and stromal matrix assembly PMID: 12381269
  13. the posterior stroma of the cornea, which is most vulnerable to lumican-deficiency, demonstrates an early developmental defect in fibril structure and architecture in the Lum-/- genotype PMID: 16786597
  14. a novel role for lumican in the presentation of bacterial lipopolysaccharide to CD14 and host response to this bacterial endotoxin. PMID: 17616530
  15. Lumican is identified as a novel regulator of angiogenesis. PMID: 17632767
  16. Homologous sequence in lumican and fibromodulin leucine-rich repeat 5-7 competes for collagen binding. PMID: 19008226

Show More

Hide All

Subcellular Location
Secreted, extracellular space, extracellular matrix.
Protein Families
Small leucine-rich proteoglycan (SLRP) family, SLRP class II subfamily
Tissue Specificity
Cornea and other tissues.
Database Links
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*