Recombinant Mycoplasma pneumoniae Methionine aminopeptidase (map)

In Stock
Code CSB-EP608941MLW
Abbreviation Recombinant Mycoplasma pneumoniae map protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
map
Uniprot No.
Research Area
Cell Biology
Alternative Names
map; MPN_186; MP645Methionine aminopeptidase; MAP; MetAP; EC 3.4.11.18; Peptidase M
Species
Mycoplasma pneumoniae (strain ATCC 29342 / M129)
Source
E.coli
Expression Region
1-248aa
Target Protein Sequence
MVYLKSAREVEQIRQACKIFQEAKAYFTIERLLGKSLTAIDQALKQFIESKGATCAFHKYQNFPGFNCLSLNETVIHGIADNRVFGVKDKLTLDIGINLNGYICDAAFTVLGPKAPEPMQTLLEVTEACFTAVVEPQLRPNNPTGNVSHAIQTYFESKGYYLLKQFGGHGCGIKVHEEPLILNYGKPDTGTKLEPGMVLCIEPMVMTDSDAMVMHNNSWNVLTPKSRYNCHVEQMYVITTSGFECLTN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
43.7kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Mycoplasma pneumoniae Methionine aminopeptidase is produced in E. coli and features an N-terminal 6xHis-SUMO tag for improved solubility and purification. The full-length protein spans amino acids 1 to 248 and is provided with a purity greater than 90% as determined by SDS-PAGE analysis. This product is intended for research use only and is not suitable for clinical applications.

Methionine aminopeptidase is an enzyme that removes the N-terminal methionine from nascent proteins—a critical step in protein maturation and function. It appears to play a key role in post-translational modification processes within cells. This protein may be significant in understanding protein processing pathways and can likely serve as an important tool in various biochemical and structural biology studies.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Mycoplasma pneumoniae Map is a metalloenzyme that requires precise folding, proper active site formation with metal ion coordination (typically cobalt or manganese), and specific tertiary structure for its enzymatic activity in protein maturation. The E. coli expression system is homologous to this bacterial enzyme, which increases the probability of correct folding. However, the large N-terminal 6xHis-SUMO tag (∼15 kDa) may sterically interfere with the protein's active site or oligomerization interfaces. While the homologous bacterial expression system favors proper folding, the probability of correct folding with full enzymatic activity requires experimental validation, particularly regarding metal ion incorporation and catalytic competence.

1. Biochemical Characterization and Enzyme Kinetics Studies

This application carries a significant risk without functional validation. Map enzymatic activity requires precise metal ion coordination and active site formation that may be compromised by the large SUMO tag. If correctly folded and metal-bound (verified through activity assays), the protein may be suitable for kinetic studies. If misfolded/inactive (unverified), kinetic measurements will yield biologically meaningless results. The SUMO tag may sterically interfere with substrate access to the active site.

2. Antibody Development and Immunological Studies

This application is highly suitable as antibody development relies on antigenic sequence recognition rather than functional enzymatic activity. The full-length protein provides comprehensive epitope coverage for generating antibodies against M. pneumoniae Map. The high purity (>90%) ensures minimal contamination-related issues during immunization protocols.

3. Protein-Protein Interaction Studies

This application requires proper folding validation. Map interactions with other proteins require native conformation. If correctly folded (verified), the protein may identify physiological interaction partners. If misfolded/unverified, there is a high risk of non-specific binding or failure to replicate genuine protein interactions in bacterial metabolic pathways.

4. Structural Biology and Biophysical Analysis

These studies are essential for determining folding status. Techniques should include circular dichroism spectroscopy to assess secondary structure, size-exclusion chromatography to evaluate oligomeric state, and metal content analysis. However, the large SUMO tag may interfere with crystallization for high-resolution structural studies and dominate the protein's biophysical properties.

5. Drug Discovery and Inhibitor Screening

This application carries a high risk without functional validation. Inhibitor screening requires native enzyme conformation and proper metal ion binding. If correctly folded and active (verified), limited screening may be possible. If misfolded/inactive (unverified), screening results will be unreliable for drug discovery due to potential false positives/negatives from altered active site geometry.

Final Recommendation & Action Plan

The E. coli expression system with a large SUMO tag poses challenges for producing a functionally active methionine aminopeptidase, despite the homologous bacterial origin. Begin with Application 4 (Structural Characterization) to assess folding quality through CD spectroscopy, SEC, and validate enzymatic activity using standard methionine aminopeptidase substrates with appropriate metal ion supplementation. Applications 1, 3, and 5 require rigorous functional validation before proceeding. Application 2 (antibody development) can proceed immediately. Consider metal ion supplementation during expression and purification, and evaluate SUMO tag removal for critical functional studies. Always include appropriate activity controls and validate key findings with tag-free protein when possible.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). Requires deformylation of the N(alpha)-formylated initiator methionine before it can be hydrolyzed.
Protein Families
Peptidase M24A family, Methionine aminopeptidase type 1 subfamily
Database Links

KEGG: mpn:MPN186

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*