Recombinant Escherichia coli Methionine aminopeptidase (map)

In Stock
Code CSB-EP360042ENV
Abbreviation Recombinant E.coli map protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
map
Uniprot No.
Research Area
Others
Alternative Names
map; b0168; JW0163Methionine aminopeptidase; MAP; MetAP; EC 3.4.11.18; Peptidase M
Species
Escherichia coli (strain K12)
Source
E.coli
Expression Region
2-264aa
Target Protein Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
45.2kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The expression of the recombinant Escherichia coli (strain K12) map protein involves the construction of a plasmid encoding the Escherichia coli (strain K12) map protein (2-264aa). This resulting plasmid is introduced into e.coli cells. Positive e.coli cells are selected and cultured for the protein expression. The protein is fused with a N-terminal 6xHis-SUMO tag. After that, cultured cells are lysed. The subsequent step includes purifying the recombinant Escherichia coli (strain K12) map protein through affinity purification from the cell lysate and assessing the purity of the protein via SDS-PAGE. The purity of the recombinant map protein is greater than 90%.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). Requires deformylation of the N(alpha)-formylated initiator methionine before it can be hydrolyzed.
Gene References into Functions
  1. These data suggest that map expression contributes to the maintenance of enteropathogenic Escherichia coli colonization. PMID: 25312947
  2. Methionine aminopeptidase associates with ribosomes via a charged loop crucial for nascent-chain processing & cell viability. It competes with peptide deformylase for binding sites at the ribosomal tunnel exit PMID: 23770820
  3. Data show that Europium ion (Eu(3+)) binds to methionine aminopeptidase and binding results in the activation of the enzyme. PMID: 22112844
  4. obtained a crystal structure for a complex of Escherichia coli methionine aminopeptidase with norleucine phosphonate, a transition-state analog, and only a single Mn(II) ion bound at the active site PMID: 16769889
Protein Families
Peptidase M24A family, Methionine aminopeptidase type 1 subfamily
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*