Recombinant Human EPO-alpha/Fc Chimera protein(EPOFc) (Active)

Code CSB-AP002091HU
Product Type Colony Stimulating Factor
Size $179Purchase it in Cusabio online store
(Shop online in the US. Customers outside the US,
please order from local distributors.)
Uniprot No. P01588
Image
Storage Buffer Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.4.
Alias Epoetin
Species Homo sapiens (Human)
Biological_Activity Fully biologically active when compared to standard. The Specific Activity was measured by the stimulation of reticulocyte production in normocyth-aemic mice and is no less than 5.0 × 10^5 IU/mg.
Purity >98% as determined by SDS-PAGE and HPLC.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR+IEGRMDEPKSSDKTHTCPPCPAPEFEGAPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPTPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Research Area Cancer
Source Mammalian cell
Gene Names EPO
Expression Region 28-193aa
Tag Info C-terminal FC-tagged
Mol. Weight 45.3 kDa
Protein Description Full Length of Mature Protein
PubMed ID 3838366; 3865178; 9799793; 12853948; 15489334; 8396923; 3949763; 6698989; 3346214; 3219367; 1820196; 11739166; 9774108; 9783743; 18458324
Still Have Questions? Leave a Message or Start an on-line Chat
Function Hormone involved in the regulation of erythrocyte proliferation and differentiation and the maintenance of a physiological level of circulating erythrocyte mass. Binds to EPOR leading to EPOR dimerization and JAK2 activation thereby activating specific downstream effectors, including STAT1 and STAT3.
Involvement in disease Microvascular complications of diabetes 2 (MVCD2)
Subcellular Location Secreted
Protein Families EPO/TPO family
Tissue Specificity Produced by kidney or liver of adult mammals and by liver of fetal or neonatal mammals.
Database Links

HGNC: 3415

OMIM: 133170

KEGG: hsa:2056

STRING: 9606.ENSP00000252723

UniGene: Hs.2303

Pathway HIF-1 signaling pathway
Jak-STAT signaling pathway
PI3K-Akt signaling pathway
Hematopoietic cell lineage

Q&A and Customer Reviews

Q&A
Q:

I have a technical question regarding Recombinant Human EPO-alpha/Fc Chimera protein (EPOFc) (Active) (CSB-AP002091HU)
Could you please let me know how precisely the amount of protein in the respective vials is measured? How does your lab quantify the amount of protein?

A:
Thanks for your inquiry.
Different protein quantification methods will have different results. Sometimes the difference in the results of quantitative methods is significant. We use the BCA method to quantify.
Customer Reviews

Related Products

EPO Antibodies

EPO Antibodies for Homo sapiens (Human)

EPO Antibodies for Human

EPO Proteins

EPO Proteins for Homo sapiens (Human)

EPO ELISA Kit

EPO ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.