Recombinant Human Erythropoietin protein(EPO) (Active)

Code CSB-AP002101HU
Product Type Colony Stimulating Factor
Size Pls inquiry other sizesPurchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. P01588
Image
Storage Buffer 0.2μm filtered sodium citrate buffer (1 liter of ddH2O containing 5.9 g of sodium citrate, 5.8 g of sodium chloride and 0.06 g of citric acid) ,lyophilized
Alias Epoetin
Species Homo sapiens (Human)
Biological_Activity Fully biologically active when compared to standard. The Specific Activity was measured by the stimulation of reticulocyte production in normocyth-aemic mice and was found to be no less than 1.5x105 IU/mg.
Purity >98% as determined by SDS-PAGE and HPLC.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR
Research Area Cancer
Source Mammalian cell
Gene Names EPO
Expression Region 28-193aa
Product Info Tag-Free
Mol. Weight 21.0 kDa
Protein Description Full Length of Mature Protein
PubMed ID 3838366; 3865178; 9799793; 12853948; 15489334; 8396923; 3949763; 6698989; 3346214; 3219367; 1820196; 11739166; 9774108; 9783743; 18458324
Still Have Questions? Leave a Message or Start an on-line Chat
Function Hormone involved in the regulation of erythrocyte proliferation and differentiation and the maintenance of a physiological level of circulating erythrocyte mass. Binds to EPOR leading to EPOR dimerization and JAK2 activation thereby activating specific downstream effectors, including STAT1 and STAT3.
Involvement in disease Microvascular complications of diabetes 2 (MVCD2)
Subcellular location Secreted
Pathway HIF-1 signaling pathway
Jak-STAT signaling pathway
PI3K-Akt signaling pathway
Hematopoietic cell lineage

Related Products

EPO Antibodies

EPO Antibodies for Homo sapiens (Human)

EPO Antibodies for Bos taurus (Bovine)

EPO Antibodies for Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

EPO Antibodies for Danio rerio (Zebrafish) (Brachydanio rerio)

EPO Proteins

EPO Proteins for Ovis aries (Sheep)

EPO Proteins for Canis lupus familiaris (Dog) (Canis familiaris)

EPO Proteins for Felis catus (Cat) (Felis silvestris catus)

EPO Proteins for Bos taurus (Bovine)

EPO Proteins for Sus scrofa (Pig)

EPO Proteins for Mus musculus (Mouse)

EPO Proteins for Bos mutus grunniens (Wild yak) (Bos grunniens)

EPO Proteins for Rattus norvegicus (Rat)

EPO Proteins for Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

EPO Proteins for Epinephelus coioides (Orange-spotted grouper) (Epinephelus nebulosus)

EPO Proteins for Takifugu rubripes (Japanese pufferfish) (Fugu rubripes)

EPO Proteins for Nannospalax galili (Northern Israeli blind subterranean mole rat) (Spalax galili)

EPO Proteins for Spalax carmeli (Southern Israeli blind subterranean mole rat)

EPO Proteins for Spalax golani (Golan Heights blind mole rat) (Nannospalax golani)

EPO Proteins for Spalax judaei (Judean Mountains blind mole rat) (Nannospalax judaei)

EPO Proteins for Equus caballus (Horse)

EPO Proteins for Oryctolagus cuniculus (Rabbit)

EPO Proteins for Microtus oeconomus (Tundra vole)

EPO Proteins for Macaca mulatta (Rhesus macaque)

EPO Proteins for Danio rerio (Zebrafish) (Brachydanio rerio)

EPO Proteins for Tetraodon nigroviridis (Spotted green pufferfish) (Chelonodon nigroviridis)

EPO Proteins for Homo sapiens (Human)

EPO cDNA

EPO cDNA for Rattus norvegicus (Rat)

EPO cDNA for Felis catus (Cat) (Felis silvestris catus)

EPO cDNA for Canis lupus familiaris (Dog) (Canis familiaris)

EPO cDNA for Macaca mulatta (Rhesus macaque)

EPO cDNA for Danio rerio (Zebrafish) (Brachydanio rerio)

EPO cDNA for Equus caballus (Horse)

EPO cDNA for Bos taurus (Bovine)

EPO cDNA for Sus scrofa (Pig)

EPO cDNA for Mus musculus (Mouse)

EPO ELISA Kit

EPO ELISA Kit for Bos taurus (Bovine)

EPO ELISA Kit for Canis lupus familiaris (Dog) (Canis familiaris)

EPO ELISA Kit for Equus caballus (Horse)

EPO ELISA Kit for Homo sapiens (Human)

EPO ELISA Kit for Macaca mulatta (Rhesus macaque)

EPO ELISA Kit for Mus musculus (Mouse)

EPO ELISA Kit for Sus scrofa (Pig)

EPO ELISA Kit for Oryctolagus cuniculus (Rabbit)

EPO ELISA Kit for Rattus norvegicus (Rat)

EPO ELISA Kit for Ovis aries (Sheep)

Most popular with customers

+ Show More

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.

Wait!

Join the 25,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now!

We don't deal in spam.