Home
Active Protein
Other
Recombinant Human MHC class I polypeptide-related sequence A (MICA), partial (Active)

Recombinant Human MHC class I polypeptide-related sequence A (MICA), partial (Active)

^{In Stock}

Code	CSB-AP005551HU
Abbreviation	Recombinant Human MICA protein, partial (Active)
MSDS	MSDS Datasheet
Size	$184
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Customer Reviews and Q&A

Product Details

Purity

Greater than 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA. Immobilized Mouse NKG2D (N-6His) at 2 μg/ml can bind Human MICA (C-Fc), the EC50 of Human MICA (C-Fc) is not higher than 10 ng/ml.

Target Names

MICA

Uniprot No.

AAH16929.1

Research Area

Signal Transduction

Alternative Names

MHC class I chain-related protein A; MHC class I chain-related protein B; MHC class I polypeptide related sequence A; MHC class I polypeptide related sequence B; MHC class I polypeptide-related sequence A; MIC-A; micA; MICA_HUMAN; MICB

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

24-308aa

Complete Sequence

EPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETEEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQ

Mol. Weight

59.9 kDa

Protein Length

Partial

Tag Info

C-terminal hFc-tagged

Form

Liquid or Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Datasheet & COA

Please contact us to get it.

Description

Recombinant Human MICA is a partial protein derived from the MHC class I polypeptide-related sequence A, representing the 23-308aa expression region. Sourced from mammalian cells and essential for signal transduction research, this protein has a C-terminal Fc-tag for enhanced detection and purification. With a purity of over 95% as confirmed by SDS-PAGE, the endotoxin levels are kept below 1.0 EU/µg, as measured by the LAL method. MICA exhibits an ED₅₀ of less than 5 μg/mL, as determined by its ability to bind Human N2DL2 in functional ELISA. The product is supplied as a lyophilized powder for ease of storage and application in various research settings.