Home
Active Protein
Other
Recombinant Human MHC class I polypeptide-related sequence A (MICA), partial (Active)

Recombinant Human MHC class I polypeptide-related sequence A (MICA), partial (Active)

^{In Stock}

Code	CSB-AP005551HU
Abbreviation	Recombinant Human MICA protein, partial (Active)
MSDS	MSDS Datasheet
Size	$184
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Customer Reviews and Q&A

Product Details

Purity

Greater than 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA. Immobilized Mouse NKG2D (N-6His) at 2 μg/ml can bind Human MICA (C-Fc), the EC50 of Human MICA (C-Fc) is not higher than 10 ng/ml.

Target Names

MICA

Uniprot No.

AAH16929.1

Research Area

Signal Transduction

Alternative Names

MHC class I chain-related protein A; MHC class I chain-related protein B; MHC class I polypeptide related sequence A; MHC class I polypeptide related sequence B; MHC class I polypeptide-related sequence A; MIC-A; micA; MICA_HUMAN; MICB

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

24-308aa

Complete Sequence

EPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETEEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQ

Mol. Weight

59.9 kDa

Protein Length

Partial

Tag Info

C-terminal hFc-tagged

Form

Liquid or Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Datasheet & COA

Please contact us to get it.

Description

MICA is a stress-induced ligand for the activating receptor NKG2D, making it a critical mediator of NK cell and cytotoxic T cell surveillance against tumors and infected cells. This recombinant human MICA construct (aa 24–308) carries a C-terminal Fc tag and demonstrates strong binding to mouse NKG2D in functional ELISA with an EC50 no higher than 10 ng/ml, providing a reliable positive control for NKG2D–ligand interaction studies and receptor-blocking assays. Mammalian cell expression preserves native glycosylation patterns essential for proper MICA folding and receptor engagement, supporting use in cell-based NK activation assays, antibody development campaigns targeting the MICA ectodomain, and surface plasmon resonance binding kinetics experiments. Purity exceeding 95% by SDS-PAGE combined with endotoxin levels below 1.0 EU/μg satisfies the criteria typical for functional cell-based assays where endotoxin-driven background activation could otherwise confound NKG2D-dependent readouts.