Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
envEnvelope glycoprotein gp160; Env polyprotein) [Cleaved into: Surface protein gp120; SU; Glycoprotein 120; gp120); Transmembrane protein gp41; TM; Glycoprotein 41; gp41)]
Species
Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) (HIV-1)
Expression Region
33-511aa
Target Protein Sequence
KLWVTVYYGVPVWKEATTTLFCASDAKAYDTEVHNVWATHACVPTDPNPQEVVLVNVTENFNMWKNDMVEQMHEDIISLWDQSLKPCVKLTPLCVSLKCTDLKNDTNTNSSSGRMIMEKGEIKNCSFNISTSIRGKVQKEYAFFYKLDIIPIDNDTTSYKLTSCNTSVITQACPKVSFEPIPIHYCAPAGFAILKCNNKTFNGTGPCTNVSTVQCTHGIRPVVSTQLLLNGSLAEEEVVIRSVNFTDNAKTIIVQLNTSVEINCTRPNNNTRKRIRIQRGPGRAFVTIGKIGNMRQAHCNISRAKWNNTLKQIASKLREQFGNNKTIIFKQSSGGDPEIVTHSFNCGGEFFYCNSTQLFNSTWFNSTWSTEGSNNTEGSDTITLPCRIKQIINMWQKVGKAMYAPPISGQIRCSSNITGLLLTRDGGNSNNESEIFRPGGGDMRDNWRSELYKYKVVKIEPLGVAPTKAKRRVVQREKR
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Amino acids 33-511 form the expressed segment for recombinant HIV-1 env. The calculated molecular weight for this env protein is 69.7 kDa. This env protein is produced using e.coli expression system. The N-terminal 6xHis-SUMO tag was smoothly integrated into the coding gene of env, which enables a simple process of detecting and purifying the env recombinant protein in the following steps.
The human immunodeficiency virus type 1 (HIV-1) group M subtype B Envelope glycoprotein gp160, commonly referred to as env, is a key structural protein of the HIV-1 virus. Env is initially synthesized as a precursor glycoprotein, gp160, which is subsequently cleaved into two subunits, gp120 and gp41, during viral maturation. Gp120 is responsible for binding to the CD4 receptor on the surface of host immune cells, initiating the viral entry process. Gp41 facilitates the fusion of the viral and host cell membranes, allowing the virus to enter the host cell. The env gene is highly variable, contributing to the extensive diversity of HIV-1, and its genetic variation poses challenges for vaccine development. Understanding the structure and function of the HIV-1 Env glycoprotein is crucial for developing strategies to combat HIV/AIDS, including the design of antiretroviral drugs and vaccines aimed at preventing viral entry and infection.