Recombinant Macaca fascicularis Erythropoietin (EPO)

In Stock
Code CSB-EP007743MOV
Abbreviation Recombinant Cynomolgus monkey EPO protein
MSDS
Size US$388
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Others
Alternative Names
EPOErythropoietin
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Source
E.coli
Expression Region
28-192aa
Target Protein Sequence
APPRLICDSRVLERYLLEAKEAENVTMGCSESCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQAVLANSSQPFEPLQLHMDKAISGLRSITTLLRALGAQEAISLPDAASAAPLRTITADTFCKLFRVYSNFLRGKLKLYTGEACRRGDR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
34.2kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

This Recombinant Macaca fascicularis Erythropoietin (EPO) is expressed in E. coli and covers the full length of the mature protein from amino acids 28 to 192. The protein comes with an N-terminal 6xHis-SUMO tag, which makes purification and detection more straightforward. SDS-PAGE analysis shows the product maintains purity levels above 90%, suggesting it's well-suited for most research applications.

Erythropoietin appears to be one of the more important glycoprotein hormones when it comes to controlling red blood cell production. The protein seems to drive erythropoiesis by encouraging both differentiation and growth of erythroid progenitor cells. Researchers have shown considerable interest in EPO's function and related pathways, especially those studying blood formation processes and exploring potential treatments for anemia and similar blood disorders.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Antibody Development and Validation Studies

This recombinant cynomolgus monkey EPO may work well as an immunogen or coating antigen when developing species-specific antibodies against primate EPO. The N-terminal His-SUMO tag makes purification relatively simple and allows for immobilization in ELISA-based antibody screening and characterization assays. With purity exceeding 90%, the protein appears suitable for immunization protocols in standard antibody production workflows. The cynomolgus monkey origin is particularly useful here - it could help develop research tools for non-human primate studies where species cross-reactivity matters.

2. Protein-Protein Interaction Studies

The His-SUMO tag system should allow for reasonably efficient pull-down assays to identify and characterize EPO binding partners or receptor interactions in vitro. Researchers can immobilize the recombinant protein on nickel-affinity resins and use it to capture interacting proteins from cell lysates or purified protein preparations. This approach might prove useful for studying EPO signaling pathway components and potentially identifying novel regulatory proteins. The mature protein sequence (28-192aa) likely represents the biologically relevant form for these interaction studies.

3. Comparative Species Analysis and Cross-Reactivity Testing

This cynomolgus monkey EPO could serve in comparative studies alongside human or other primate EPO variants to assess species-specific differences in protein structure and immunological properties. The recombinant protein may work as a reference standard for evaluating cross-reactivity of EPO-targeting research reagents across primate species. Such studies appear valuable for understanding evolutionary conservation of EPO and for validating research tools intended for non-human primate models.

4. Biochemical Characterization and Stability Studies

The purified recombinant protein can undergo various biochemical analyses including mass spectrometry, circular dichroism spectroscopy, and thermal stability assays to characterize its biophysical properties. The >90% purity level seems adequate for most analytical techniques commonly used in protein characterization. These studies might provide insights into the folding, stability, and structural features of cynomolgus monkey EPO compared to other species variants.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Hormone involved in the regulation of erythrocyte proliferation and differentiation and the maintenance of a physiological level of circulating erythrocyte mass. Binds to EPOR leading to EPOR dimerization and JAK2 activation thereby activating specific downstream effectors, including STAT1 and STAT3.
Subcellular Location
Secreted.
Protein Families
EPO/TPO family
Tissue Specificity
Produced by kidney or liver of adult mammals and by liver of fetal or neonatal mammals.
Database Links

UniGene: Mfa.5395

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*