Recombinant Macaca fascicularis Erythropoietin (EPO)

In Stock
Code CSB-EP007743MOV
Abbreviation Recombinant Cynomolgus monkey EPO protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Others
Alternative Names
EPOErythropoietin
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Source
E.coli
Expression Region
28-192aa
Target Protein Sequence
APPRLICDSRVLERYLLEAKEAENVTMGCSESCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQAVLANSSQPFEPLQLHMDKAISGLRSITTLLRALGAQEAISLPDAASAAPLRTITADTFCKLFRVYSNFLRGKLKLYTGEACRRGDR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
34.2kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

This Recombinant Macaca fascicularis Erythropoietin (EPO) is expressed in E. coli and covers the full length of the mature protein from amino acids 28 to 192. The protein comes with an N-terminal 6xHis-SUMO tag, which makes purification and detection more straightforward. SDS-PAGE analysis shows the product maintains purity levels above 90%, suggesting it's well-suited for most research applications.

Erythropoietin appears to be one of the more important glycoprotein hormones when it comes to controlling red blood cell production. The protein seems to drive erythropoiesis by encouraging both differentiation and growth of erythroid progenitor cells. Researchers have shown considerable interest in EPO's function and related pathways, especially those studying blood formation processes and exploring potential treatments for anemia and similar blood disorders.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

EPO is a complex glycoprotein hormone that requires specific glycosylation patterns for proper folding, stability, and biological activity. The E. coli expression system cannot perform the necessary post-translational modifications (particularly N-linked glycosylation) that are essential for EPO's structural integrity and function. While the SUMO tag may improve solubility, the protein will lack the carbohydrate modifications critical for receptor binding and signaling activity. Therefore, this recombinant EPO is highly unlikely to achieve correct tertiary structure or possess any meaningful biological activity, though it may maintain some secondary structural elements.

1. Antibody Development and Validation Studies

This recombinant EPO serves as an excellent immunogen for generating antibodies against the polypeptide backbone of cynomolgus monkey EPO. The full-length mature protein sequence ensures comprehensive linear epitope coverage. However, antibodies produced against this non-glycosylated form may not efficiently recognize the native, glycosylated EPO found in biological systems, particularly in assays requiring conformational epitopes.

2. Comparative Species Analysis and Cross-Reactivity Testing

This protein can be used for limited comparative studies focusing on polypeptide sequence differences between species. However, for functional or immunological comparisons that depend on glycosylation patterns (which significantly influence half-life and immunogenicity), the data will be misleading as it lacks the natural post-translational modifications.

3. Biochemical Characterization and Stability Studies

This is an essential application for understanding the properties of this specific recombinant protein. Techniques like circular dichroism can assess secondary structure content, while thermal shift assays can determine stability under various conditions. However, the results will reflect the behavior of a non-glycosylated EPO variant, not the native glycosylated protein.

Final Recommendation & Action Plan

This recombinant EPO is valuable for immunological applications and biochemical characterization, but is fundamentally unsuitable for any functional studies due to the lack of essential glycosylation. The recommended approach is to prioritize Application 3 (Biochemical Characterization) to establish the protein's stability and structural properties, then proceed with Application 1 (Antibody Development) for generating sequence-specific antibodies. Application 2 should be limited to polypeptide-level comparisons only. Non-glycosylated EPO cannot form the proper tertiary structure required for specific interaction with the EPO receptor (EPOR). It may exhibit non-specific binding or fail to recognize genuine interaction partners, making any interaction data biologically irrelevant and misleading. For functional EPO studies, alternative approaches using mammalian expression systems (e.g., CHO cells) that provide proper glycosylation are necessary.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Hormone involved in the regulation of erythrocyte proliferation and differentiation and the maintenance of a physiological level of circulating erythrocyte mass. Binds to EPOR leading to EPOR dimerization and JAK2 activation thereby activating specific downstream effectors, including STAT1 and STAT3.
Subcellular Location
Secreted.
Protein Families
EPO/TPO family
Tissue Specificity
Produced by kidney or liver of adult mammals and by liver of fetal or neonatal mammals.
Database Links

UniGene: Mfa.5395

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*