Recombinant Macaca fascicularis Erythropoietin (EPO)

In Stock
Code CSB-MP007743MOV
Abbreviation Recombinant Cynomolgus monkey EPO protein
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cardiovascular
Alternative Names
EPOErythropoietin
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Source
Mammalian cell
Expression Region
28-192aa
Target Protein Sequence
APPRLICDSRVLERYLLEAKEAENVTMGCSESCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQAVLANSSQPFEPLQLHMDKAISGLRSITTLLRALGAQEAISLPDAASAAPLRTITADTFCKLFRVYSNFLRGKLKLYTGEACRRGDR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
22.2 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Macaca fascicularis Erythropoietin (EPO) is produced in a mammalian cell expression system, which appears to ensure appropriate post-translational modifications. The protein corresponds to the full-length mature sequence and includes an N-terminal 6xHis-Myc tag for ease of purification and detection. With a purity greater than 85% as determined by SDS-PAGE, this product seems suitable for research applications requiring high-quality recombinant proteins.

Erythropoietin (EPO) is a vital glycoprotein hormone primarily responsible for regulating red blood cell production (erythropoiesis) in the bone marrow. It plays an essential role in maintaining the oxygen-carrying capacity of the blood and serves as a key factor in response to hypoxia. EPO is also involved in various signaling pathways and has become a significant focus in hematology and regenerative medicine research.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Comparative Protein Structure and Function Studies

This recombinant cynomolgus monkey EPO may serve as a valuable tool for comparative studies examining structural and functional differences between primate and human erythropoietin. The N-terminal 6xHis-Myc tag enables easy purification and detection, making it suitable for biochemical characterization assays. These might include protein folding studies, glycosylation pattern analysis, and stability assessments. Researchers can potentially investigate evolutionary conservation of EPO across primate species through comparative proteomics approaches.

2. Antibody Development and Cross-Reactivity Testing

The tagged cynomolgus EPO could function as an antigen for generating species-specific antibodies or testing cross-reactivity of existing anti-human EPO antibodies. The His-tag allows for immobilization on nickel-coated surfaces for ELISA-based antibody screening and characterization assays. This application may be particularly valuable for researchers developing antibodies intended for use in non-human primate studies or investigating species-specific epitope recognition patterns.

3. Protein-Protein Interaction Studies

The dual His-Myc tagging system makes this protein suitable for pull-down assays to identify potential binding partners or cofactors that interact with cynomolgus EPO. Researchers can potentially use the His-tag for immobilization on affinity columns and the Myc-tag for detection in Western blot analysis of pulled-down complexes. This approach may enable investigation of EPO-mediated protein interactions in primate-specific cellular contexts.

4. In Vitro Assay Development and Validation

This recombinant protein could serve as a standard or control in developing cell-based assays using cynomolgus monkey cell lines or primary cells. The high purity level (>85%) makes it suitable for dose-response studies and assay optimization experiments. Researchers might use this protein to establish baseline parameters for in vitro studies that could later translate to non-human primate preclinical models.

5. Immunogenicity and Safety Assessment Studies

The recombinant cynomolgus EPO can be used in preclinical immunogenicity studies to evaluate potential immune responses in non-human primate models. Researchers may use this protein to assess antibody formation, complement activation, or cytokine release in ex vivo assays using primate immune cells. The mammalian expression system likely ensures proper post-translational modifications relevant for immunogenicity assessment studies.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Hormone involved in the regulation of erythrocyte proliferation and differentiation and the maintenance of a physiological level of circulating erythrocyte mass. Binds to EPOR leading to EPOR dimerization and JAK2 activation thereby activating specific downstream effectors, including STAT1 and STAT3.
Subcellular Location
Secreted.
Protein Families
EPO/TPO family
Tissue Specificity
Produced by kidney or liver of adult mammals and by liver of fetal or neonatal mammals.
Database Links

UniGene: Mfa.5395

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*