Code | CSB-EP301675ECY |
Size | US$2466 |
Image |
Purity | Greater than 90% as determined by SDS-PAGE. |
Target Names | IX |
Uniprot No. | P69538 |
Research Area | Microbiology |
Alternative Names | Coat protein C, polypeptide II G9P |
Species | Enterobacteria phage M13 (Bacteriophage M13) |
Source | E.coli |
Expression Region | 1-32aa |
Target Protein Sequence | MSVLVYSFASFVLGWCLRSGITYFTRLMETSS Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Mol. Weight | 19.7kDa |
Protein Length | Full Length |
Tag Info | N-terminal 6xHis-SUMO-tagged |
Form |
Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. |
Datasheet & COA | Please contact us to get it. |
Still Have Questions? | Leave a Message or Start an on-line Chat |
Function | May initiate with G7P the virion concomitant assembly-budding process, by interacting with the packaging signal of the viral genome. The assembly-budding takes place at the host inner membrane. In turn, G7P and G9P are present at the end of the filamentous virion that emerges first from the bacterial host. |
Subcellular Location | Virion, Host membrane, Single-pass membrane protein |
Protein Families | Inovirus G9P protein family |
Database Links |
KEGG: vg:927332 |
Recombinant Human Prolactin-inducible protein(PIP)
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human T-cell surface glycoprotein CD1c(CD1C),partial
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human LIM domain transcription factor LMO4(LMO4)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human T-cell surface glycoprotein CD8 alpha chain(CD8A),partial
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human Neurofilament light polypeptide(NEFL)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Integrin alpha-IIb(ITGA2B),partial
Express system: E.coli
Species: Homo sapiens (Human)
Tel: 301-363-4651
Email: support@cusabio.com
Distributors Worldwide