Recombinant Enterobacteria phage M13 (Bacteriophage M13) Tail virion protein G9P

Code CSB-EP301675ECY
Product Type Recombinant Protein
Size US$2466
Uniprot No. P69538
Relevance May initiate with G7P the virion concomitant assembly-budding process, by interacting with the packaging signal of the viral genome. The assembly-budding takes place at the host inner membrane. In turn, G7P and G9P are present at the end of the filamentous virion that emerges first from the bacterial host.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Coat protein C, polypeptide II G9P
Species Enterobacteria phage M13 (Bacteriophage M13)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MSVLVYSFASFVLGWCLRSGITYFTRLMETSS
Research Area Microbiology
Source E.coli
Gene Names IX
Expression Region 1-32aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 19.7kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May initiate with G7P the virion concomitant assembly-budding process, by interacting with the packaging signal of the viral genome. The assembly-budding takes place at the host inner membrane. In turn, G7P and G9P are present at the end of the filamentous virion that emerges first from the bacterial host.
Subcellular Location Virion, Host membrane, Single-pass membrane protein
Protein Families Inovirus G9P protein family
Database Links

KEGG: vg:927332

Related Products

IX Antibodies

IX Antibodies for Enterobacteria phage M13

IX Proteins

IX Proteins for Enterobacteria phage M13 (Bacteriophage M13)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.