Recombinant Equine herpesvirus 4 Envelope glycoprotein G(gG)

Code CSB-CF330186EFR
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P32650
Storage Buffer Tris-based buffer,50% glycerol
Species Equine herpesvirus 4 (strain 1942) (EHV-4) (Equine rhinopneumonitis virus)
Sequence RLAPDDLCYAEPRKTGPMPRSKPKHQPLLFEAPKVALTAESKGCQLILLDPPIDMGYRLE DKINASIAWFFDFGNCRMPIAYREYYDCVGNAIPSPETCDGYSFTLVKTEGVVEFTIVNM SLLLQPGIYDSGSFIYSALLDMDVLTGRVILNVENDTNYPCGMTHGLTADGNINVDETTH TTPHPRAVGCFPELINFDAWENVTFEEMGIPDPNSFLDDESDYPNTMDCYSWDLYTYPKS LKQAEGPQTLLIGAVGLRILAQAWKFVENETYSQHTRTYTRDAKEVDVTQPSPVQADSVL AKKRTSMKNNPIYSEGKPHAKPFSTIDSIHTEGMKNNPVYSESLMLNVQHSDSITTGGVL HGLQDCDNQLKTVYICLALIGLAHVP
Source in vitro E.coli expression system
Gene Names gG
Protein Names Recommended name: Envelope glycoprotein G Short name= gG
Expression Region 20-405
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Chemokine-binding protein that inhibits neutrophils' chemotaxis.
Subcellular Location Virion membrane, Single-pass type I membrane protein
Protein Families Alphaherpesvirinae glycoprotein G family

Related Products

gG Proteins

gG Proteins for Equine herpesvirus 4 (strain 1942) (EHV-4) (Equine rhinopneumonitis virus)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.