Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

Uniprot No.

P06484

Research Area

Others

Alternative Names

gG; US4; Envelope glycoprotein G; gG; gG-1

Species

Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus 1)

Source

E.coli

Expression Region

25-189aa

Target Protein Sequence

VPTNVSSTTQPQLQTTGRPSHEAPNMTQTGTTDSPTAISLTTPDHTPPMPSIGLEEEEEEEGAGDGEHLEGGDGTRDTLPQSPGPAFPLAEDVEKDKPNRPVVPSPDPNNSPARPETSRPKTPPTIIGPLATRPTTRLTSKGRPLVPTPQHTPLFSFLTASPALD
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

33.4 kDa

Protein Length

Partial

Tag Info

N-terminal 6xHis-SUMO-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Explore the world of virology research with our Recombinant Human herpesvirus 1 Envelope glycoprotein G, a specialized protein that can enhance your understanding of viral entry and pathogenesis in Human herpesvirus 1 (HHV-1) infections. Envelope glycoprotein G, encoded by the gG (US4) gene, is a significant protein in the Human herpesvirus 1 (strain 17) that plays crucial roles in the virus life cycle, including cell entry and immune evasion.

Our Recombinant Human herpesvirus 1 Envelope glycoprotein G is produced using E.coli expression systems and represents a partial protein spanning the 25-189 amino acid expression region. This protein features an N-terminal 6xHis-SUMO tag for streamlined purification and detection processes. With a purity greater than 90% as determined by SDS-PAGE, our recombinant protein offers reliable performance and reproducibility in your experiments. This product is available in both liquid and lyophilized powder forms, providing flexibility for various research applications.

Target Background

Function

Chemokine-binding protein that inhibits neutrophils' chemotaxis.

Gene References into Functions

HSV-1 Us3 is a multifunctional protein that plays various roles in the viral life cycle by phosphorylating a number of viral and cellular substrates. [review] PMID: 29896662
It regulates the pathogenicity of herpes simplex virus type-1 PMID: 28484184
This study identifies the alphaherpesvirus-specific Us3 kinase as an mTORC1 activator that subverts the host cell energy-sensing program to support viral productive growth irrespective of physiological stress. PMID: 28468873
findings show that Us8A is a virulence factor for HSV-1 infection in mice, and the function of Us8A for viral invasion into the central nervous system from peripheral sites is regulated by Us3-mediated phosphorylation of the protein at Ser-61. PMID: 27030266
The difference between HSV-1 and HSV-2 Us3 kinases appeared to be due to the fact that some Us3 phosphorylation sites in HSV-1 proteins are not conserved in the corresponding HSV-2 proteins. PMID: 26491159
Us3 enables the nucleus to cytoplasm capsid translocation. Nevertheless, Us3 is not essential for the production of infective progeny viruses. PMID: 25588052
HSV-1-encoded Us3 protein interrupted TCR signaling and interleukin-2 production by inactivation of the linker for activation of T cells. PMID: 25907557
Ablation of this phosphorylation abolished herpes simplex virus 1 US3-mediated downregulation of CD1d expression, suggesting that phosphorylation of KIF3A is the primary mechanism of viral suppression of CD1d expression. PMID: 25878107
This study demonstrated that herpes simplex virus 1 protein kinase US3 significantly inhibited NF-kappaB activation via hyperphosphorylation of p65 and decreased the expression of inflammatory chemokine interleukin-8 (IL-8). PMID: 24807716
Sufficient dUTPase activity was required for efficient herpes simplex virus 1 replication and Us3 phosphorylation of viral dUTPase Ser-187 upregulated dUTPase activity in host cells with low cellular dUTPase activity. PMID: 24760895
STING is stable in cancer-derived HEp-2 or HeLa cells infected with wild-type HSV-1 but is degraded in cells infected with mutants lacking the genes encoding functional infected cell protein 0 (ICP0), ICP4, or the US3 protein kinase PMID: 24449861
Herpes simplex virus 1 US3 hyperphosphorylates IRF3 and inhibits beta interferon production. PMID: 24049179
Human herpesvirus 1 US3 is necessary and sufficient for inhibiting TLR2 signaling at or before the stage of TRAF6 ubiquitination. PMID: 23478027
US3 plays a significant role in down-regulation of membrane biosynthesis. PMID: 22789738
These results suggested that Us3 phosphorylation of UL47 Ser-77 promoted the nuclear localization of UL47 in cell cultures and played a critical role in viral replication and pathogenesis in vivo. PMID: 21734045
identified gB and US3 as two viral factors that together downregulate CD1d surface expression; results suggest that HSV-1 uses gB and US3 to rapidly inhibit NKT cell function in the initial antiviral response PMID: 21653669
The authors demonstrated that Us3 phosphorylation of glycoprotein B Thr-887 upregulated the accumulation of endocytosed of glycoprotein B from the surfaces of infected cells. PMID: 21389132
Us3 is an Akt surrogate with overlapping substrate specificity to activate mTORC1, stimulating translation and virus replication PMID: 21123650
Us3 phosphorylation of gB Thr-887 played a critical role in viral replication in vivo and in HSV-1 pathogenesis PMID: 19846518
This prostein accumulates in cells infected with the mutant lacking the gene encoding ICP22 mediated the phosphorylation of histone deacetylase. PMID: 15956590
U(S)3 and U(S)3.5 protein kinases of herpes simplex virus 1 differ with respect to their functions in blocking apoptosis and in virion maturation and egress. PMID: 16571792
U(S)3 protein kinase blocks histone deacetylation by a mechanism distinct from that of ICP0. PMID: 16785443
It was concluded that US3 was mediating the suppression of mitochondrial respiration following HHV-1 infection. PMID: 16847111
Us3, Us5, and Us12 viral genes each have unique inhibitory effects on the different T lymphocyte cytotoxic effects PMID: 16987059
US3 blocks the proteolytic cleavage that generates active caspase 3 from the transfected zymogen procaspase 3, concomitant with inhibition of apoptosis. PMID: 17634220
These results supported the hypothesis that Us3 phosphorylates gB and downregulates the cell surface expression of gB in HSV-1-infected cells. PMID: 18945776
The majority of the US3-dependent phosphorylation of gB involved the CT domain and amino acid T887, a residue present in a motif similar to that recognized by US3 in other proteins. PMID: 19158241
US3-mediated phosphorylation of UL31 is critical to regulate nuclear egress. PMID: 19279109
regulation of Us3 activity by autophosphorylation appeared to play a critical role in viral replication in vivo and in HSV-1 pathogenesis PMID: 19297494
regulatory and functional effects differ from Us3 protein kinase in herpes simplex virus 2 PMID: 19740999

Hide All

Subcellular Location

Virion membrane; Single-pass type I membrane protein.

Protein Families

Alphaherpesvirinae glycoprotein G family

Database Links

KEGG: vg:2703404

Code	CSB-EP361844HWY1
Abbreviation	Recombinant Human herpesvirus 1 gG protein, partial
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human herpesvirus 1 Envelope glycoprotein G (gG), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage