Recombinant Newcastle disease virus Hemagglutinin-neuraminidase (HN),Partial

In Stock
Code CSB-EP336075NCW1
Abbreviation Recombinant Newcastle disease virus Hemagglutinin-neuraminidase protein, partial
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
HN
Uniprot No.
Research Area
others
Alternative Names
HN; Hemagglutinin-neuraminidase; EC 3.2.1.18
Species
Newcastle disease virus (strain Her/33) (NDV)
Source
E.coli
Expression Region
115-473aa
Target Protein Sequence
NGAANNSGCGAPVHDPDYIGGIGKELIVDDASDVTSFYPSAFQEHLNFIPAPTTGSGCTRIPSFDISATHYCYTHNVILSGCRDHSHSHQYLALGVLRTSATGRVFFSTLRSINLDDNQNRKSCSVSATPLGCDMLCSKITETEEEDYSSVTPTSMVHGRLGFDGQYHEKDLDVITLFKDWVANYPGVGGGSFIDNRVWFPVYGGLKPNSPSDTVQEGRYVIYKRYNDTCPDEQDYQIRMAKSSYKPGRFGGKRVQQAILSIKVSTSLGEDPVLTIPPNTVTLMGAEGRVLTVGTSHFLYQRGSSYFSPALLYPMTVNNKTATLHSPYTFNAFTRPGSVPCQASARCPNSCVTGVYTDP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
44.2kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Newcastle disease virus Hemagglutinin-neuraminidase (HN) is expressed in E. coli and covers the 115-473 amino acid region of the protein. This partial protein carries dual tags—an N-terminal 10xHis-tag and a C-terminal Myc-tag—which help with purification and detection. SDS-PAGE analysis confirms the product purity exceeds 85%. This product is designed for research use only and is not intended for therapeutic or diagnostic applications.

The Hemagglutinin-neuraminidase (HN) protein appears to play a critical role in Newcastle disease virus biology. It handles viral attachment to host cells and helps drive the fusion process during viral entry. HN also shows neuraminidase activity, which seems essential for viral spread through cleaving sialic acid residues. This protein has become a significant target in virology research, particularly when studying how viral infection works.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Newcastle disease virus biologNewcastle disease virus Hemagglutinin-neuraminidase (HN) is a complex viral glycoprotein that requires precise folding, proper disulfide bond formation, glycosylation at specific asparagine residues, tetramerization, and specific tertiary structure for its functional activity in receptor binding and neuraminidase activity. The E. coli expression system cannot provide the eukaryotic folding environment, oxidative conditions for correct disulfide bond formation, or glycosylation machinery required for this viral glycoprotein. The partial fragment (115-473aa) lacks critical N-terminal domains and the complete structural context. The dual N-terminal 10xHis-tag and C-terminal Myc-tag are large relative to the fragment and will severely sterically interfere with the protein's functional domains. The probability of correct folding with functional receptor-binding or neuraminidase activity is essentially zero.

1. Antigen for Anti-NDV Antibody Development

This application has limited utility. While antibodies can be generated against linear epitopes within this fragment, they will not recognize conformational epitopes of the full-length, glycosylated HN protein in its native viral context. Antibodies may primarily target the foreign tags rather than the viral protein domain.

2. Structural and Biochemical Characterization Studies

Basic biophysical analysis can be performed, but will not reflect native HN structure. The lack of glycosylation and proper disulfide bonding means results will describe an artificial protein fragment rather than the authentic viral glycoprotein. The tags will dominate all physical properties.

Final Recommendation & Action Plan

This dual-tagged HN fragment expressed in E. coli is fundamentally unsuitable for meaningful HN research due to the essential requirements for glycosylation, proper disulfide bonding, and tetramerization that cannot be met in this expression system. The protein should not be used for interaction studies and receptor binding, as they would yield biologically irrelevant results. Application 1 (antibody development) has severe limitations due to conformational epitope mismatch. Application 2 provides only a basic characterization of the tagged fragment. For reliable HN research, use full-length protein expressed in mammalian or insect cell systems that support proper glycosylation, disulfide bond formation, and native conformational epitopes.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Mediates the viral entry into the host cell together with fusion/F protein. Attaches the virus to sialic acid-containing cell receptors and thereby initiates infection. Binding of HN protein to the receptor induces a conformational change that allows the F protein to trigger virion/cell membranes fusion.; Neuraminidase activity ensures the efficient spread of the virus by dissociating the mature virions from the neuraminic acid containing glycoproteins.
Subcellular Location
Virion membrane; Single-pass type II membrane protein. Host cell membrane; Single-pass type II membrane protein.
Protein Families
Paramyxoviruses hemagglutinin-neuraminidase family
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*