Recombinant Newcastle disease virus Hemagglutinin-neuraminidase (HN),Partial

In Stock
Code CSB-EP336075NCW1
Abbreviation Recombinant Newcastle disease virus Hemagglutinin-neuraminidase protein, partial
MSDS
Size US$388
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
HN
Uniprot No.
Research Area
others
Alternative Names
HN; Hemagglutinin-neuraminidase; EC 3.2.1.18
Species
Newcastle disease virus (strain Her/33) (NDV)
Source
E.coli
Expression Region
115-473aa
Target Protein Sequence
NGAANNSGCGAPVHDPDYIGGIGKELIVDDASDVTSFYPSAFQEHLNFIPAPTTGSGCTRIPSFDISATHYCYTHNVILSGCRDHSHSHQYLALGVLRTSATGRVFFSTLRSINLDDNQNRKSCSVSATPLGCDMLCSKITETEEEDYSSVTPTSMVHGRLGFDGQYHEKDLDVITLFKDWVANYPGVGGGSFIDNRVWFPVYGGLKPNSPSDTVQEGRYVIYKRYNDTCPDEQDYQIRMAKSSYKPGRFGGKRVQQAILSIKVSTSLGEDPVLTIPPNTVTLMGAEGRVLTVGTSHFLYQRGSSYFSPALLYPMTVNNKTATLHSPYTFNAFTRPGSVPCQASARCPNSCVTGVYTDP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
44.2kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Newcastle disease virus Hemagglutinin-neuraminidase (HN) is expressed in E. coli and covers the 115-473 amino acid region of the protein. This partial protein carries dual tags—an N-terminal 10xHis-tag and a C-terminal Myc-tag—which help with purification and detection. SDS-PAGE analysis confirms the product purity exceeds 85%. This product is designed for research use only and is not intended for therapeutic or diagnostic applications.

The Hemagglutinin-neuraminidase (HN) protein appears to play a critical role in Newcastle disease virus biology. It handles viral attachment to host cells and helps drive the fusion process during viral entry. HN also shows neuraminidase activity, which seems essential for viral spread through cleaving sialic acid residues. This protein has become a significant target in virology research, particularly when studying how viral infection works.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Antigen for Anti-NDV Antibody Development

This recombinant HN protein fragment (115-473aa) may serve as an immunogen for generating polyclonal or monoclonal antibodies against Newcastle disease virus hemagglutinin-neuraminidase protein. The His and Myc tags make purification and detection straightforward during antibody screening. Researchers can immunize laboratory animals with this protein, then screen hybridoma clones or check serum antibody responses. The high purity (>85%) should minimize cross-reactivity with bacterial contaminants during immunization.

2. Protein-Protein Interaction Studies Using Tag-Based Pull-Down Assays

Both the N-terminal His-tag and C-terminal Myc-tag allow this recombinant HN protein to work in pull-down experiments aimed at identifying cellular proteins that interact with viral hemagglutinin-neuraminidase. Researchers can attach the protein to nickel-affinity resins through the His-tag or use anti-Myc antibodies for immunoprecipitation work. Cell lysates from different host species can be mixed with the immobilized HN protein to grab potential binding partners. Mass spectrometry analysis of co-purified proteins might reveal new host-pathogen interaction networks.

3. ELISA-Based Binding Assays for Receptor Studies

This tagged HN protein fragment appears useful for developing enzyme-linked immunosorbent assays to study receptor binding specificity and kinetics. The protein can coat ELISA plates and test binding to various sialic acid-containing glycoproteins or synthetic receptor analogs. The Myc-tag provides standardized detection through anti-Myc antibodies, which allows quantitative measurement of binding interactions. These assays could help researchers explore receptor binding domain characteristics within the 115-473aa region.

4. Structural and Biochemical Characterization Studies

The recombinant HN protein fragment provides material for biophysical characterization techniques like circular dichroism spectroscopy, dynamic light scattering, and analytical ultracentrifugation. The defined amino acid boundaries (115-473aa) let researchers examine folding properties and stability of this specific domain region. The dual tagging system makes protein quantification and tracking easier during biochemical assays. Such studies may offer insights into the structural properties of this particular HN domain when produced in bacterial systems.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Mediates the viral entry into the host cell together with fusion/F protein. Attaches the virus to sialic acid-containing cell receptors and thereby initiates infection. Binding of HN protein to the receptor induces a conformational change that allows the F protein to trigger virion/cell membranes fusion.; Neuraminidase activity ensures the efficient spread of the virus by dissociating the mature virions from the neuraminic acid containing glycoproteins.
Subcellular Location
Virion membrane; Single-pass type II membrane protein. Host cell membrane; Single-pass type II membrane protein.
Protein Families
Paramyxoviruses hemagglutinin-neuraminidase family
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*