Recombinant Newcastle disease virus Hemagglutinin-neuraminidase(HN),partial

Code CSB-YP336075NCW1
Product Type Recombinant Protein
Size US$2959
Uniprot No. P35741
Relevance Attaches the virus to sialic acid-containing cell receptors and thereby initiating infection. Binding of HN protein to the receptor induces a conformational change that allows the F protein to trigger virion/cell membranes fusionNeuraminidase activity ensures the efficient spread of the virus by dissociating the mature virions from the neuraminic acid containing glycoproteins.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Newcastle disease virus (strain Her/33) (NDV)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence NGAANNSGCGAPVHDPDYIGGIGKELIVDDASDVTSFYPSAFQEHLNFIPAPTTGSGCTRIPSFDISATHYCYTHNVILSGCRDHSHSHQYLALGVLRTSATGRVFFSTLRSINLDDNQNRKSCSVSATPLGCDMLCSKITETEEEDYSSVTPTSMVHGRLGFDGQYHEKDLDVITLFKDWVANYPGVGGGSFIDNRVWFPVYGGLKPNSPSDTVQEGRYVIYKRYNDTCPDEQDYQIRMAKSSYKPGRFGGKRVQQAILSIKVSTSLGEDPVLTIPPNTVTLMGAEGRVLTVGTSHFLYQRGSSYFSPALLYPMTVNNKTATLHSPYTFNAFTRPGSVPCQASARCPNSCVTGVYTDP
Research Area others
Source Yeast
Gene Names HN
Protein Names Recommended name: Hemagglutinin-neuraminidase EC= 3.2.1.18
Expression Region 115-473aa
Tag Info N-terminal 6xHis-tagged and C-terminal Myc-tagged
Mol. Weight 42.7kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Attaches the virus to sialic acid-containing cell receptors and thereby initiating infection. Binding of HN protein to the receptor induces a conformational change that allows the F protein to trigger virion/cell membranes fusion (By similarity).
Subcellular Location Virion membrane, Single-pass type II membrane protein, Host cell membrane, Single-pass type II membrane protein
Protein Families Paramyxoviruses hemagglutinin-neuraminidase family

Related Products

HN Antibodies

HN Antibodies for Newcastle disease virus (strain Her/33) (NDV)

HN Proteins

HN Proteins for Newcastle disease virus (strain Her/33) (NDV)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.