Recombinant Escherichia coli Peptide deformylase (def)

In Stock
Code CSB-EP017707ENV
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
def
Uniprot No.
Research Area
Others
Alternative Names
def; fms; b3287; JW3248Peptide deformylase; PDF; EC 3.5.1.88; Polypeptide deformylase
Species
Escherichia coli (strain K12)
Source
E.coli
Expression Region
2-169aa
Target Protein Sequence
SVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSENRDERLVLINPELLEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLSPLKQQRIRQKVEKLDRLKARA
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
35.2kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The preparation of this recombinant E.coli def protein was to use gene recombination DNA technology to obtain a recombinant vector connected with a def fragment (2-169aa) that could be translated into the def protein and then transferred it into E.coli cells to express the recombinant def protein molecule. In order to get the target protein with high purity, N-terminal 6xHis-SUMO tag was used in the production. The purity is 90% determined by SDS-PAGE.

Peptide deformylase catalyzes the hydrolytic removal of the N-terminal formyl group from nascent proteins. This is an essential step in bacterial protein synthesis, making PDF an attractive target for antibacterial drug development. Peptide deformylase activity was first reported by Adams in 1968. However, further attempts to purify the enzyme from cell lysates failed because the activity was not stable. The enzyme was not characterized further until the early 1990s, when the deformylase gene, def, was cloned and peptide deformylase was subsequently overexpressed in Escherichia coli. Bacterial peptide deformylase belongs to a new class of metallohydrolases that utilize an Fe2+ ion as the catalytic metal ion. The ferrous ion in peptide deformylase is very unstable and can be quickly and irreversibly oxidized to the ferric ion, resulting in an inactive enzyme.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Removes the formyl group from the N-terminal Met of newly synthesized proteins. Requires at least a dipeptide for an efficient rate of reaction. N-terminal L-methionine is a prerequisite for activity but the enzyme has broad specificity at other positions.
Gene References into Functions
  1. Peptide deformylase has very fast association & dissociation kinetics which allows it to frequently sample ribosomes & ensure the processing of nascent chains after emergence. It competes with methionine aminopeptidase for ribosomal tunnel-exit binding sites. PMID: 23770820
Protein Families
Polypeptide deformylase family
Database Links
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*