Recombinant Chlamydia trachomatis Major outer membrane porin, serovar A (ompA)

In Stock
Code CSB-EP328425DSA
Abbreviation Recombinant Chlamydia trachomatis ompA protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP328425DSA could indicate that this peptide derived from E.coli-expressed Chlamydia trachomatis ompA.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP328425DSA could indicate that this peptide derived from E.coli-expressed Chlamydia trachomatis ompA.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
ompA
Uniprot No.
Research Area
Others
Alternative Names
ompA; omp1A; Major outer membrane porin; serovar A; MOMP
Species
Chlamydia trachomatis
Source
E.coli
Expression Region
23-396aa
Target Protein Sequence
LPVGNPAEPSLMIDGILWEGFGGDPCDPCTTWCDAISMRMGYYGDFVFDRVLKTDVNKEFQMGAAPTTRDVAGLEKDPVVNVARPNPAYGKHMQDAEMFTNAAYMALNIWDRFDVFCTLGATTGYLKGNSASFNLVGLFGTKTQSSGFDTANIVPNTALNQAVVELYTDTTFAWSVGARAALWECGCATLGASFQYAQSKPKVEELNVLCNASEFTINKPKGYVGAEFPLDITAGTEAATGTKDASIDYHEWQASLALSYRLNMFTPYIGVKWSRVSFDADTIRIAQPKLAKPVLDTTTLNPTIAGKGTVVSSAENELADTMQIVSLQLNKMKSRKSCGIAVGTTIVDADKYAVTVETRLIDERAAHVNAQFRF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
56.6kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

This recombinant Chlamydia trachomatis Major outer membrane porin (ompA), serovar A, is expressed in E. coli and contains the full length of the mature protein (23-396aa). It comes with an N-terminal 6xHis-SUMO tag that helps with purification and detection. SDS-PAGE analysis confirms the product shows purity levels above 90%, which appears to provide reliable performance for research applications.

The Major outer membrane porin of Chlamydia trachomatis, often called ompA, seems to play an important role in bacterial outer membrane structure. This protein is involved in maintaining membrane integrity and permeability, and it also functions in immune responses during infection. Given its significance in cellular interactions and potential as a vaccine target, ompA has become a key focus in microbial pathogenesis research.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Antibody Development and Characterization Studies

This recombinant ompA protein can work as an immunogen for creating monoclonal or polyclonal antibodies specific to Chlamydia trachomatis serovar A. The N-terminal His-SUMO tag makes purification and immobilization easier for antibody screening assays. Scientists can apply this protein in ELISA-based assays to study antibody specificity, affinity, and cross-reactivity with other chlamydial serovars. The high purity (>90%) should help deliver consistent and reproducible results in immunological assays.

2. Protein-Protein Interaction Studies

The His-SUMO tagged ompA works well in pull-down assays to find host cell proteins that interact with the major outer membrane porin. The His tag allows immobilization on nickel-affinity matrices, while the SUMO tag offers additional purification options and may help stabilize the protein. This method can help researchers understand molecular mechanisms of chlamydial pathogenesis and host-pathogen interactions in controlled laboratory systems.

3. Structural and Biochemical Characterization

This recombinant protein offers a useful tool for studying the structural properties and biochemical features of Chlamydia trachomatis ompA. Researchers can apply techniques like circular dichroism spectroscopy, dynamic light scattering, and analytical ultracentrifugation. Since the mature protein region (23-396aa) is expressed in E. coli, it allows for isotopic labeling studies and NMR analysis. Scientists can examine protein folding, stability, and conformational changes under different buffer conditions and temperatures.

4. Vaccine Research and Immunogenicity Studies

The recombinant ompA protein can be used in preclinical vaccine development studies to measure immune responses in animal models. Researchers might evaluate the immunogenicity of various adjuvant formulations and delivery methods using this purified antigen. The protein serves as a standardized antigen for comparing immune responses across different experimental conditions and for fine-tuning vaccine formulations in laboratory settings.

5. Serovar-Specific Research Applications

This serovar A-specific ompA protein makes comparative studies possible with ompA proteins from other Chlamydia trachomatis serovars. Researchers can identify sequence and structural differences that may contribute to serovar specificity. Scientists can use this protein in competitive binding assays and cross-reactivity studies to better understand antigenic variation among different chlamydial strains. The standardized recombinant format should allow for consistent comparative analyses across multiple research laboratories.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
In elementary bodies (EBs, the infectious stage, which is able to survive outside the host cell) provides the structural integrity of the outer envelope through disulfide cross-links with the small cysteine-rich protein and the large cysteine-rich periplasmic protein. It has been described in publications as the Sarkosyl-insoluble COMC (Chlamydia outer membrane complex), and serves as the functional equivalent of peptidoglycan.; Permits diffusion of specific solutes through the outer membrane.
Subcellular Location
Cell outer membrane; Multi-pass membrane protein.
Protein Families
Chlamydial porin (CP) (TC 1.B.2) family
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*