Recombinant Escherichia coli Outer membrane protein A (ompA)-VLPs

Code CSB-MP364256ENV(A4)
MSDS
Size
Order now
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
ompA
Uniprot No.
Research Area
Metabolism
Alternative Names
ompA; con; tolG; tut; b0957; JW0940; Outer membrane protein A; OmpA; Outer membrane porin A; Outer membrane protein 3A; Outer membrane protein B; Outer membrane protein II*; Outer membrane protein d
Species
Escherichia coli (strain K12)
Source
Mammalian cell
Expression Region
22-346aa
Target Protein Sequence
APKDNTWYTGAKLGWSQYHDTGFINNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGSVENGAYKAQGVQLTAKLGYPITDDLDIYTRLGGMVWRADTKSNVYGKNHDTGVSPVFAGGVEYAITPEIATRLEYQWTNNIGDAHTIGTRPDNGMLSLGVSYRFGQGEAAPVVAPAPAPAPEVQTKHFTLKSDVLFNFNKATLKPEGQAALDQLYSQLSNLDPKDGSVVVLGYTDRIGSDAYNQGLSERRAQSVVDYLISKGIPADKISARGMGESNPVTGNTCDNVKQRAALIDCLAPDRRVEIEVKGIKDVVTQPQA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal 10xHis-tagged
If you have specified tag type, please tell us and we will check if it’s possible to develop.
Form
Lyophilized powder
Note: We will default ship it in lyophilized form with normal bule ice packs. However, if you request to ship in liquid form, it needs to be shipped with dry ice, please communicate with us in advance and extra fees for dry ice and dry ice box will be charged.
Buffer
Lyophilized from PBS, 6% Trehalose, pH 7.4
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store the protein at -20°C/-80°C upon receiving it, and ensure to avoid repeated freezing and thawing, otherwise, it will affect the protein activity.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
With TolR probably plays a role in maintaining the position of the peptidoglycan cell wall in the periplasm (Probable). Plays a role in resistance to environmental stress, and a role in outer membrane functionality and cell shape. Non-covalently binds peptidoglycan (Probable). Acts as a porin with low permeability that allows slow penetration of small solutes. A very abundant protein, there can be up to 210,000 OmpA molecules per cell. Reconstitution in unilamellar lipid vesicles shows only about 3% of the protein is in an open conformation, which allows diffusion of L-arabinose at a rate comparable to that of OmpF porin; the pores interconvert very rarely. Native and reconstituted protein forms ion channels with 2 conductance states of (50-80 pS) and (260-320 pS); the states are interconvertible in this study. Interconversion requires refolding of the periplasmic domain. Small pores are converted into large pores by increasing temperature; in this model the C-terminal periplasmic domain forms 8 more beta sheets to form a larger pore. The center of the isolated beta-barrel is polar and has a central gate (involving Glu-73, Lys-103, Glu-149 and Arg-159, sandwiched between Tyr-29, Phe-40 and Tyr-94), with no obvious passage for water or ions (Probable). Gating involves the Glu-73-Arg-159 salt bridge; gate opening probably involves formation of alternate salt bridges Glu-149-Arg-159 and Glu-73-Lys-103. Modeling suggests that non-covalent binding of OmpA (from the outer membrane) and TolR (from the inner membrane) to peptidoglycan maintains the position of the cell wall in the periplasm, holding it approximately equidistant from both the inner and outer membranes. Trimeric Lpp controls the width of the periplasm, adjusts its tilt angle to accommodate to the available space, and can compensate in part for an absence of OmpA (Probable).; Required for F plasmid cell conjugation; purified protein plus lipopolysaccharide (LPS) inhibits conjugation in a concentration-dependent manner. OmpA probably acts as the receptor on recipient cells (Probable). Required for the stabilization of mating aggregates during F plasmid conjugative transfer, may interact with F plasmid-encoded TraN, but not with TraN from plasmid R100-1. All 4 external, surface-exposed loops are required for F plasmid conjugation.; (Microbial infection) Mutants with decreased or altered protein are resistant to bacteriophage TuII*. Mutants which have no or greatly reduced protein levels are resistant to a number of bacteriophages, including K3, K4, K5, Ox2, Ox3, Ox4, Ox5, Ml, and Ac3 (Probable). Mutations in this protein render the bacteria partially or completely susceptible to a number of bacteriophages for which is it probably the receptor. All but the last external, surface-exposed loops are required for phage K3 infection.; (Microbial infection) A mutation in this locus (called tolG) renders the cell tolerant to bacteriocin JF246 but does not affect its sensitivity to colicins A, C, El, E2, E3, K, Ia, or Ib. Mutations in this protein render the bacteria partially or completely susceptible to colicin K or colicin L, for which is it probably the receptor.
Gene References into Functions
  1. Data indicate the possibility of concatemers of outer membrane protein A (OmpA) either folding directly or forming domain swaps under folding conditions, which can either unfold back to the denatured state or fold directly to the native concatemeric state. PMID: 27973779
  2. Data suggest a multistep folding mechanism for outer membrane protein A (OmpA) that includes unstructured surface-adsorbed states converting through a partially inserted state with substantial beta-sheet structure to the final natively inserted barrel. PMID: 28001375
  3. The results suggest that the periplasmic domain slows down the rate, while improves the efficiency, of OmpA folding and membrane insertion under the crowding condition. PMID: 23225740
  4. The contribution of lipid solvation of tryptophans to the stability of OmpA is evaluated by calculating the difference in unfolding free energy. PMID: 23763479
  5. In vitro, OmpA+ Escherichia coli infection selectively upregulates Ecgp96 and TLR2 in human brain microvascular endothelial cells (HBMEC), whereas OmpA- E. coli upregulates TLR4 in these cells. PMID: 22963587
  6. OmpA periplasmic domain exists as an independent folding unit with a free energy of folding equal to -6.2 (+/-0.1) kcal mol(-1) at 25 degrees C. PMID: 21782315
  7. The stability of ompA mRNA was reduced in the presence of glucose. PMID: 21840983
  8. Cellular invasion was shown to require activation of host cytosolic phospholipase A2 (cPLA2alpha) by Loops1 and 2 but not 3 of Escherichia coli OmpA. PMID: 21148506
  9. Data show that disulfide bond formation and temperature play decisive roles in folding OmpA into its native large-pore. configuration. PMID: 21069910
  10. Mutation in loops 1, 2, and 4 resulted in significant inhibition of E. coli K1 invasion in human brain microvascular endothelial cells. PMID: 20851887
  11. single-mutants S163 and S167 of OmpA, which still contain cOHB on one serine of the sorting signal, form narrow pores in planar lipid bilayers at room temperature with lower and more irregular conductance than wild-type OmpA PMID: 20004640
  12. the structure of the SecB/OmpA complex was visualized by electron microscopy. The binding pattern between SecB tetramer and OmpA is asymmetric. PMID: 20170640
  13. Stable E. coli mRNAs as lpp and ompA were drastically destabilized immediately after phage T4 infection. PMID: 15476881
  14. evidence for convergent evolution; results indicate that large quantities of OmpA are secreted into the medium during all phases of growth, where it is present both in secreted vesicles and as a soluble secreted protein PMID: 15595387
  15. Results indicate that the two-domain structure of OmpA is a partially folded intermediate that is kinetically stable at lower temperatures and that mature fully folded OmpA is a large pore. PMID: 15850404
  16. results indicate that distinct regulatory circuits are responsible for growth phase- and growth rate-dependent control of the ompA mRNA stability PMID: 16313626
  17. controlled post-transcriptionally by RnaseR PMID: 16556233
  18. Bacteriophage sensitivity testing indicated an association between bacteriophage resistance and isolates having the novel ompA allele PMID: 16980421
  19. the beta-barrel platform (BBP) and BBP plus the EF motif in dihexanoylphosphatidylcholine micelles are eight-stranded antiparallel beta-barrels PMID: 17260943
  20. can function as an adhesin and invasin, participate in biofilm formation, act as both an immune target and evasin, and serves as a receptor for several bacteriophages. PMID: 17559395
  21. polarity analysis of the secretory protein proOmpA and protein-conducting channel SecYEG PMID: 17699162
  22. Data show that Stat3 activation and its interaction with Ec-gp96, which in turn interacts with E. coli outer membrane protein A, are critical for E. coli invasion. PMID: 18662321
  23. while bound to Skp, the beta-barrel domain of OmpA is maintained in an unfolded state, whereas the periplasmic domain is folded in its native conformation, allowig the transport of beta-barrels across the periplasm in an unfolded state PMID: 19181847
  24. Negatively charged lipopolysaccharide binds to OmpA-seventeen kDa protein (Skp) complexes, leading to a partial release of OmpA from the complex. The turn regions of OmpA remain bound to Skp. PMID: 19382746

Show More

Hide All

Subcellular Location
Cell outer membrane; Multi-pass membrane protein.
Protein Families
OmpA family
Database Links
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*