Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
| Code | CSB-MP364256ENV(A4) |
| Size | |
| Have Questions? | Leave a Message or Start an on-line Chat |
| Target Names | ompA |
| Uniprot No. | P0A910 |
| Research Area | Metabolism |
| Alternative Names | ompA; con; tolG; tut; b0957; JW0940; Outer membrane protein A; OmpA; Outer membrane porin A; Outer membrane protein 3A; Outer membrane protein B; Outer membrane protein II*; Outer membrane protein d |
| Species | Escherichia coli (strain K12) |
| Source | Mammalian cell |
| Expression Region | 22-346aa |
| Target Protein Sequence | APKDNTWYTGAKLGWSQYHDTGFINNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGSVENGAYKAQGVQLTAKLGYPITDDLDIYTRLGGMVWRADTKSNVYGKNHDTGVSPVFAGGVEYAITPEIATRLEYQWTNNIGDAHTIGTRPDNGMLSLGVSYRFGQGEAAPVVAPAPAPAPEVQTKHFTLKSDVLFNFNKATLKPEGQAALDQLYSQLSNLDPKDGSVVVLGYTDRIGSDAYNQGLSERRAQSVVDYLISKGIPADKISARGMGESNPVTGNTCDNVKQRAALIDCLAPDRRVEIEVKGIKDVVTQPQA Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
| Tag Info |
C-terminal 10xHis-tagged If you have specified tag type, please tell us and we will check if it’s possible to develop. |
| Form |
Lyophilized powder Note: We will default ship it in lyophilized form with normal bule ice packs. However, if you request to ship in liquid form, it needs to be shipped with dry ice, please communicate with us in advance and extra fees for dry ice and dry ice box will be charged. |
| Buffer | Lyophilized from PBS, 6% Trehalose, pH 7.4 |
| Troubleshooting and FAQs |
Protein FAQs |
| Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Lead Time | Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. Note: Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. |
| Notes | Repeated freezing and thawing is not recommended. Store the protein at -20°C/-80°C upon receiving it, and ensure to avoid repeated freezing and thawing, otherwise, it will affect the protein activity. |
| Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
| Function |
With TolR probably plays a role in maintaining the position of the peptidoglycan cell wall in the periplasm (Probable). Plays a role in resistance to environmental stress, and a role in outer membrane functionality and cell shape. Non-covalently binds peptidoglycan (Probable). Acts as a porin with low permeability that allows slow penetration of small solutes. A very abundant protein, there can be up to 210,000 OmpA molecules per cell. Reconstitution in unilamellar lipid vesicles shows only about 3% of the protein is in an open conformation, which allows diffusion of L-arabinose at a rate comparable to that of OmpF porin; the pores interconvert very rarely. Native and reconstituted protein forms ion channels with 2 conductance states of (50-80 pS) and (260-320 pS); the states are interconvertible in this study. Interconversion requires refolding of the periplasmic domain. Small pores are converted into large pores by increasing temperature; in this model the C-terminal periplasmic domain forms 8 more beta sheets to form a larger pore. The center of the isolated beta-barrel is polar and has a central gate (involving Glu-73, Lys-103, Glu-149 and Arg-159, sandwiched between Tyr-29, Phe-40 and Tyr-94), with no obvious passage for water or ions (Probable). Gating involves the Glu-73-Arg-159 salt bridge; gate opening probably involves formation of alternate salt bridges Glu-149-Arg-159 and Glu-73-Lys-103. Modeling suggests that non-covalent binding of OmpA (from the outer membrane) and TolR (from the inner membrane) to peptidoglycan maintains the position of the cell wall in the periplasm, holding it approximately equidistant from both the inner and outer membranes. Trimeric Lpp controls the width of the periplasm, adjusts its tilt angle to accommodate to the available space, and can compensate in part for an absence of OmpA (Probable).; Required for F plasmid cell conjugation; purified protein plus lipopolysaccharide (LPS) inhibits conjugation in a concentration-dependent manner. OmpA probably acts as the receptor on recipient cells (Probable). Required for the stabilization of mating aggregates during F plasmid conjugative transfer, may interact with F plasmid-encoded TraN, but not with TraN from plasmid R100-1. All 4 external, surface-exposed loops are required for F plasmid conjugation.; (Microbial infection) Mutants with decreased or altered protein are resistant to bacteriophage TuII*. Mutants which have no or greatly reduced protein levels are resistant to a number of bacteriophages, including K3, K4, K5, Ox2, Ox3, Ox4, Ox5, Ml, and Ac3 (Probable). Mutations in this protein render the bacteria partially or completely susceptible to a number of bacteriophages for which is it probably the receptor. All but the last external, surface-exposed loops are required for phage K3 infection.; (Microbial infection) A mutation in this locus (called tolG) renders the cell tolerant to bacteriocin JF246 but does not affect its sensitivity to colicins A, C, El, E2, E3, K, Ia, or Ib. Mutations in this protein render the bacteria partially or completely susceptible to colicin K or colicin L, for which is it probably the receptor.
|
| Gene References into Functions |
|
| Subcellular Location | Cell outer membrane; Multi-pass membrane protein. |
| Protein Families | OmpA family |
| Database Links |
KEGG: ecj:JW0940 STRING: 316385.ECDH10B_1027 |
