Recombinant Aspergillus restrictus Ribonuclease mitogillin (ret)

In Stock
Code CSB-EP303691APQ
Abbreviation Recombinant Aspergillus restrictus ret protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Others
Alternative Names
ret; Ribonuclease mitogillin; EC 3.1.27.-; Restrictocin
Species
Aspergillus restrictus
Source
E.coli
Expression Region
28-176aa
Target Protein Sequence
ATWTCINQQLNPKTNKWEDKRLLYSQAKAESNSHHAPLSDGKTGSSYPHWFTNGYDGNGKLIKGRTPIKFGKADCDRPPKHSQNGMGKDDHYLLEFPTFPDGHDYKFDSKKPKEDPGPARVIYTYPNKVFCGIVAHQRGNQGDLRLCSH
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
23.9 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Aspergillus restrictus Ribonuclease mitogillin (ret) is produced in E. coli and contains the full-length mature protein from amino acids 28 to 176. The protein includes an N-terminal 10xHis-tag and a C-terminal Myc-tag, which makes purification and detection more straightforward. SDS-PAGE analysis indicates the protein's purity exceeds 85%, suggesting it may be suitable for reliable research applications. This product is intended for research use only.

Ribonuclease mitogillin from Aspergillus restrictus appears to be a ribonuclease enzyme recognized for its role in cleaving RNA molecules. Researchers commonly study it for its enzymatic activity and potential applications in molecular biology research. Understanding how such ribonucleases work and what they do could provide insights into RNA processing and degradation—processes that seem crucial in various cellular and molecular pathways.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Ribonuclease mitogillin is a fungal ribotoxin that requires precise disulfide bond formation and specific tertiary structure for its enzymatic activity and target recognition. The E. coli expression system cannot provide the eukaryotic folding environment or post-translational modifications necessary for this complex protein. Additionally, the dual N-terminal and C-terminal tags may sterically interfere with proper folding and active site formation. While the protein may be soluble, the probability of correct folding with functional ribonuclease activity is extremely low.

1. Antibody Development and Immunoassay Optimization

This recombinant protein serves as an excellent immunogen for generating antibodies against linear epitopes of mitogillin. The dual tags provide additional epitopes for antibody screening. However, antibodies may not recognize conformational epitopes on the native, properly folded protein.

2. Comparative Structural and Biochemical Analysis

This is the essential first step to assess the protein's physical properties. Techniques like circular dichroism can analyze secondary structure, while size-exclusion chromatography can determine oligomeric state. These studies provide critical quality control data but characterize the protein itself, not the native protein.

Final Recommendation & Action Plan

The E. coli expression system is fundamentally unsuitable for producing a functional fungal ribonuclease, limiting applications to non-functional uses. The immediate priority is Application 2 (Biochemical Characterization) to assess the protein's physical state. Application 1 (Antibody Development) can proceed confidently for generating linear epitope antibodies. Ribonuclease interactions require precise tertiary structure. A misfolded, tagged variant will yield misleading results. Cellular localization is dependent on native structure and function, which this misfolded protein cannot provide. For functional studies, ribonuclease mitogillin from fungal expression systems or native purification is essential.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
This purine-specific ribonuclease cleaves 28S RNA in eukaryotic ribosomes, inhibits protein synthesis, and shows antitumor activity.
Subcellular Location
Secreted.
Protein Families
Ribonuclease U2 family
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*