Recombinant Aspergillus restrictus Ribonuclease mitogillin (ret)

In Stock
Code CSB-EP303691APQ
Abbreviation Recombinant Aspergillus restrictus ret protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Others
Alternative Names
ret; Ribonuclease mitogillin; EC 3.1.27.-; Restrictocin
Species
Aspergillus restrictus
Source
E.coli
Expression Region
28-176aa
Target Protein Sequence
ATWTCINQQLNPKTNKWEDKRLLYSQAKAESNSHHAPLSDGKTGSSYPHWFTNGYDGNGKLIKGRTPIKFGKADCDRPPKHSQNGMGKDDHYLLEFPTFPDGHDYKFDSKKPKEDPGPARVIYTYPNKVFCGIVAHQRGNQGDLRLCSH
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
23.9 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Aspergillus restrictus Ribonuclease mitogillin (ret) is produced in E. coli and contains the full-length mature protein from amino acids 28 to 176. The protein includes an N-terminal 10xHis-tag and a C-terminal Myc-tag, which makes purification and detection more straightforward. SDS-PAGE analysis indicates the protein's purity exceeds 85%, suggesting it may be suitable for reliable research applications. This product is intended for research use only.

Ribonuclease mitogillin from Aspergillus restrictus appears to be a ribonuclease enzyme recognized for its role in cleaving RNA molecules. Researchers commonly study it for its enzymatic activity and potential applications in molecular biology research. Understanding how such ribonucleases work and what they do could provide insights into RNA processing and degradation—processes that seem crucial in various cellular and molecular pathways.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Protein-Protein Interaction Studies Using Dual-Tag Pull-Down Assays

The N-terminal His-tag and C-terminal Myc-tag offer versatile handles for investigating potential binding partners of ribonuclease mitogillin in fungal cellular extracts or purified protein libraries. This dual-tag system allows for sequential purification steps. It may also help confirm interactions through independent capture methods. Researchers can immobilize the protein via either tag to nickel-affinity or anti-Myc antibody matrices and identify co-purifying proteins through mass spectrometry analysis. This approach appears particularly valuable for understanding the cellular context and regulatory networks that might involve this ribonuclease in fungal systems.

2. Antibody Development and Immunoassay Optimization

The recombinant protein with 85% purity serves as what seems to be an appropriate immunogen for generating polyclonal or monoclonal antibodies specific to Aspergillus restrictus ribonuclease mitogillin. The dual-tag configuration could enable comprehensive antibody characterization through tag-specific controls and competition assays. Researchers can develop ELISA-based detection systems using the Myc-tag for capture and test antibodies for detection. This approach likely helps with antibody screening and validation processes. The purified recombinant protein also provides what appears to be a reliable standard for quantitative immunoassays in fungal research applications.

3. Comparative Structural and Biochemical Analysis

The mature protein region (28-176aa) expressed in E. coli provides material for comparative studies with other fungal ribonucleases through techniques such as circular dichroism spectroscopy, dynamic light scattering, and limited proteolysis mapping. Researchers can investigate the protein's stability under various buffer conditions, pH ranges, and temperature profiles to understand its biochemical properties better. The His-tag makes rapid purification possible for multiple analytical preparations, while the defined expression region allows for direct comparison with other characterized ribonuclease domains from related species.

4. Tag-Mediated Protein Localization and Trafficking Studies

The C-terminal Myc-tag may enable researchers to track the recombinant protein's behavior in cell-free systems or permeabilized cell models using anti-Myc antibodies and fluorescent detection methods. This application could prove valuable for studying potential cellular targeting mechanisms or membrane association properties of the ribonuclease when introduced into fungal cell extracts or reconstituted cellular systems. The dual-tag system provides internal controls for specificity. It also allows for orthogonal detection methods in complex experimental setups, though the effectiveness might vary depending on the specific experimental conditions.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
This purine-specific ribonuclease cleaves 28S RNA in eukaryotic ribosomes, inhibits protein synthesis, and shows antitumor activity.
Subcellular Location
Secreted.
Protein Families
Ribonuclease U2 family
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*