Code | CSB-EP006735HUb0 |
Abbreviation | Recombinant Human DES protein |
MSDS | |
Size | $256 |
Order now | |
Image | |
Have Questions? | Leave a Message or Start an on-line Chat |
There are currently no reviews for this product.
I want to conduct Sandwich ELISA assay, I have the antibody CSB-PA13149D0Rb and another secondary antibody now, which antigen will I use to coat the plate?
I advise you the protein CSB-EP006735HUb0.
Product Name: Recombinant Human Desmin(DES)
Expression system: E.coli
Expression region: 2-470aa; Full Length of Mature Protein
Tag information: N-terminal 10xHis-tagged
Target Protein Sequence (The complete sequence will be provided upon request, including tag sequence, target protein sequence and linker sequence):
SQAYSSSQRVSSYRRTFGGAPGFPLGSPLSSPVFPRAGFGSKGSSSSVTSRVYQVSRTSGGAGGLGSLRASRLGTTRTPSSYGAGELLDFSLADAVNQEFLTTRTNEKVELQELNDRFANYIEKVRFLEQQNAALAAEVNRLKGREPTRVAELYEEELRELRRQVEVLTNQRARVDVERDNLLDDLQRLKAKLQEEIQLKEEAENNLAAFRADVDAATLARIDLERRIESLNEEIAFLKKVHEEEIRELQAQLQEQQVQVEMDMSKPDLTAALRDIRAQYETIAAKNISEAEEWYKSKVSDLTQAANKNNDALRQAKQEMMEYRHQIQSYTCEIDALKGTNDSLMRQMRELEDRFASEASGYQDNIARLEEEIRHLKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQQHEVL
Product Type: In Stock Recombinant Protein
Lead time: 3-7 business days