| Code | CSB-EP006735HUb0 | 
| Abbreviation | Recombinant Human DES protein | 
| MSDS | |
| Size | $256 | 
| Order now | |
| Image | |
| Have Questions? | Leave a Message or Start an on-line Chat | 
There are currently no reviews for this product.
I want to conduct Sandwich ELISA assay, I have the antibody CSB-PA13149D0Rb and another secondary antibody now, which antigen will I use to coat the plate?
I advise you the protein CSB-EP006735HUb0.
Product Name:  Recombinant Human Desmin(DES)
Expression system:  E.coli
Expression region:  2-470aa; Full Length of Mature Protein
Tag information:  N-terminal 10xHis-tagged
Target Protein Sequence (The complete sequence will be provided upon request, including tag sequence, target protein sequence and linker sequence): 
SQAYSSSQRVSSYRRTFGGAPGFPLGSPLSSPVFPRAGFGSKGSSSSVTSRVYQVSRTSGGAGGLGSLRASRLGTTRTPSSYGAGELLDFSLADAVNQEFLTTRTNEKVELQELNDRFANYIEKVRFLEQQNAALAAEVNRLKGREPTRVAELYEEELRELRRQVEVLTNQRARVDVERDNLLDDLQRLKAKLQEEIQLKEEAENNLAAFRADVDAATLARIDLERRIESLNEEIAFLKKVHEEEIRELQAQLQEQQVQVEMDMSKPDLTAALRDIRAQYETIAAKNISEAEEWYKSKVSDLTQAANKNNDALRQAKQEMMEYRHQIQSYTCEIDALKGTNDSLMRQMRELEDRFASEASGYQDNIARLEEEIRHLKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQQHEVL
Product Type:  In Stock Recombinant Protein
Lead time:  3-7 business days