Recombinant Chlamydia trachomatis Major outer membrane porin, serovar B (ompA)

In Stock
Code CSB-EP332912DSA
Abbreviation Recombinant Chlamydia trachomatis ompA protein
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
ompA
Uniprot No.
Research Area
Microbiology
Alternative Names
ompA; omp1B; Major outer membrane porin; serovar B; MOMP
Species
Chlamydia trachomatis
Source
E.coli
Expression Region
23-394aa
Target Protein Sequence
LPVGNPAEPSLMIDGILWEGFGGDPCDPCTTWVDAISMRMGYYGDFVFDRVLKTDVNKEFQMGAKPTTTTGNAVAPSTLTARENPAYGRHMQDAEMFTNAACMALNIWDRFDVFCTLGASSGYLKGNSASFNLVGLFGNNENQTKVSNGAFVPNMSLDQSVVELYTDTAFAWSVGARAALWECGCATLGASFQYAQSKPKVEELNVLCNAAEFTINKPKGYVGKELPLDLTAGTDAATGTKDASIDYHEWQASLALSYRLNMFTPYIGVKWSRASFDADTIRIAQPKSAETIFDVTTLNPTIAGAGDVKTSAEGQLGDTMQIVSLQLNKMKSRKSCGIAVGTTIVDADKYAVTVETRLIDERAAHVNAQFRF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
47.7 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

This recombinant Chlamydia trachomatis Major outer membrane porin, serovar B (ompA) comes from an E. coli expression system and contains the full length of the mature protein (23-394aa). The protein carries both an N-terminal 10xHis-tag and C-terminal Myc-tag, which makes purification and detection more straightforward. SDS-PAGE analysis shows purity levels exceeding 85%, suggesting it should work well for different research applications.

The major outer membrane porin (ompA) of Chlamydia trachomatis appears to be essential for maintaining the bacterial outer membrane's structural integrity and controlling what passes through it. This component likely helps keep the membrane stable while managing the transport of small molecules. Researchers studying bacterial pathogenesis and looking for new therapeutic targets may find understanding its function and how it interacts with host cells particularly valuable.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Chlamydia trachomatis Major outer membrane porin (OmpA) is a bacterial membrane protein that requires precise folding, beta-barrel formation, and proper membrane integration for its porin activity. The E. coli expression system is homologous to this bacterial membrane protein and contains the necessary machinery for outer membrane protein folding, increasing the probability of correct beta-barrel formation. However, membrane proteins present additional folding challenges, and the dual N-terminal 10xHis tag and C-terminal Myc tag may interfere with proper membrane integration or beta-barrel assembly. While E. coli expression provides favorable conditions for bacterial membrane proteins, experimental validation remains essential to confirm structural integrity and porin activity.

1. Antibody Development and Validation Studies

This application is highly suitable as antibody development primarily relies on antigenic sequence recognition. If correctly folded (as verified), the protein excels at generating conformation-sensitive antibodies that recognize native OmpA epitopes. If misfolded/unverified, it remains suitable for producing antibodies against linear epitopes, which are still valuable for diagnostic applications.

2. Protein-Protein Interaction Studies

Membrane protein interactions depend on correct beta-barrel formation and surface epitope presentation. This application requires proper folding validation. Porin interactions with host receptors or other bacterial proteins require precise tertiary structure. If correctly folded (verified), the protein is suitable for identifying physiological interaction partners. If misfolded/unverified, there is a high risk of non-specific binding or interaction failure.

3. Immunological Assay Development

Assay development relies on consistent antigen availability and detection, not functional conformation. This application is well-suited regardless of folding status. Immunoassays depend on antibody-epitope binding rather than functional activity. If correctly folded (verified), the protein provides authentic antigenic presentation. If misfolded/unverified, it remains effective as a standardized antigen for assay development.

4. Biochemical Characterization Studies

These studies are essential for determining folding status. Biochemical characterization provides valuable physical property (oligomerization, stability, and membrane integration properties) data for validating membrane protein folding and quality, not the native OmpA.

Final Recommendation & Action Plan

The E. coli expression system provides a suitable homologous environment for this bacterial membrane protein, but experimental validation of structural integrity is essential before functional applications. Begin with Application 4 (Biophysical Characterization) to assess folding quality through size-exclusion chromatography (oligomerization state), circular dichroism spectroscopy (beta-sheet content), and liposome reconstitution assays to test porin activity. Once correct folding and membrane integration are verified, proceed cautiously with Application 2 for interaction studies. Applications 1 and 3 (antibody development and immunoassays) can proceed immediately regardless of folding status. If misfolding is detected, limit applications to linear epitope antibody production and immunoassay standardization, avoiding all functional interaction studies. For reliable OmpA research, consider incorporating detergent screening and membrane mimetic systems to maintain protein stability during experiments.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
In elementary bodies (EBs, the infectious stage, which is able to survive outside the host cell) provides the structural integrity of the outer envelope through disulfide cross-links with the small cysteine-rich protein and the large cysteine-rich periplasmic protein. It has been described in publications as the Sarkosyl-insoluble COMC (Chlamydia outer membrane complex), and serves as the functional equivalent of peptidoglycan.; Permits diffusion of specific solutes through the outer membrane.
Subcellular Location
Cell outer membrane; Multi-pass membrane protein.
Protein Families
Chlamydial porin (CP) (TC 1.B.2) family
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*