Recombinant Chlamydia trachomatis Major outer membrane porin, serovar B (ompA)

In Stock
Code CSB-EP332912DSA
Abbreviation Recombinant Chlamydia trachomatis ompA protein
MSDS
Size $388
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
ompA
Uniprot No.
Research Area
Microbiology
Alternative Names
ompA; omp1B; Major outer membrane porin; serovar B; MOMP
Species
Chlamydia trachomatis
Source
E.coli
Expression Region
23-394aa
Target Protein Sequence
LPVGNPAEPSLMIDGILWEGFGGDPCDPCTTWVDAISMRMGYYGDFVFDRVLKTDVNKEFQMGAKPTTTTGNAVAPSTLTARENPAYGRHMQDAEMFTNAACMALNIWDRFDVFCTLGASSGYLKGNSASFNLVGLFGNNENQTKVSNGAFVPNMSLDQSVVELYTDTAFAWSVGARAALWECGCATLGASFQYAQSKPKVEELNVLCNAAEFTINKPKGYVGKELPLDLTAGTDAATGTKDASIDYHEWQASLALSYRLNMFTPYIGVKWSRASFDADTIRIAQPKSAETIFDVTTLNPTIAGAGDVKTSAEGQLGDTMQIVSLQLNKMKSRKSCGIAVGTTIVDADKYAVTVETRLIDERAAHVNAQFRF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
47.7 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

This recombinant Chlamydia trachomatis Major outer membrane porin, serovar B (ompA) comes from an E. coli expression system and contains the full length of the mature protein (23-394aa). The protein carries both an N-terminal 10xHis-tag and C-terminal Myc-tag, which makes purification and detection more straightforward. SDS-PAGE analysis shows purity levels exceeding 85%, suggesting it should work well for different research applications.

The major outer membrane porin (ompA) of Chlamydia trachomatis appears to be essential for maintaining the bacterial outer membrane's structural integrity and controlling what passes through it. This component likely helps keep the membrane stable while managing the transport of small molecules. Researchers studying bacterial pathogenesis and looking for new therapeutic targets may find understanding its function and how it interacts with host cells particularly valuable.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Antibody Development and Validation Studies

Researchers can use this recombinant C. trachomatis OmpA protein as an immunogen to create polyclonal or monoclonal antibodies against the major outer membrane porin. The dual-tag design—with its N-terminal His-tag and C-terminal Myc-tag—simplifies both purification and detection during antibody screening. Since the expressed mature protein region (23-394aa) represents the native antigenic surface that appears during natural infections, it may produce antibodies that recognize native epitopes effectively. Scientists could then validate these antibodies through Western blot, ELISA, or immunofluorescence assays using the recombinant protein.

2. Protein-Protein Interaction Studies

Pull-down assays can take advantage of this dual-tagged recombinant OmpA to hunt for potential binding partners or host cell receptors that might interact with C. trachomatis outer membrane components. The N-terminal His-tag works well for attachment to nickel-based affinity matrices, while the C-terminal Myc-tag offers another way to detect the protein and check its integrity during interaction experiments. Researchers can incubate cell lysates or purified candidate proteins with immobilized OmpA to look for specific binding interactions under controlled laboratory conditions.

3. Immunological Assay Development

This recombinant protein may serve as a standardized antigen for creating and fine-tuning various immunoassays, including ELISA-based detection systems and immunoblotting protocols. The >85% purity level should be adequate for use as a coating antigen or positive control in serological research. The dual-tag system helps with assay development by offering multiple detection approaches and allowing precise measurement of protein loading in experimental setups.

4. Biochemical Characterization Studies

Scientists can subject the purified recombinant OmpA protein to various biochemical analyses to examine its physicochemical properties—things like thermal stability, pH sensitivity, and how it behaves in different detergents. Size exclusion chromatography and dynamic light scattering experiments might reveal insights into the protein's oligomerization state and whether it tends to aggregate under different buffer conditions. These studies could help build a better understanding of this important chlamydial surface protein's basic biochemical behavior in controlled laboratory settings.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
In elementary bodies (EBs, the infectious stage, which is able to survive outside the host cell) provides the structural integrity of the outer envelope through disulfide cross-links with the small cysteine-rich protein and the large cysteine-rich periplasmic protein. It has been described in publications as the Sarkosyl-insoluble COMC (Chlamydia outer membrane complex), and serves as the functional equivalent of peptidoglycan.; Permits diffusion of specific solutes through the outer membrane.
Subcellular Location
Cell outer membrane; Multi-pass membrane protein.
Protein Families
Chlamydial porin (CP) (TC 1.B.2) family
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*